BLASTX nr result
ID: Cinnamomum23_contig00032230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00032230 (232 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011398378.1| hypothetical protein F751_0509 [Auxenochlore... 74 3e-11 ref|XP_002948144.1| hypothetical protein VOLCADRAFT_88469 [Volvo... 72 2e-10 ref|XP_005851579.1| hypothetical protein CHLNCDRAFT_138082 [Chlo... 71 2e-10 >ref|XP_011398378.1| hypothetical protein F751_0509 [Auxenochlorella protothecoides] gi|675353042|gb|KFM25482.1| hypothetical protein F751_0509 [Auxenochlorella protothecoides] Length = 472 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/63 (55%), Positives = 47/63 (74%) Frame = -1 Query: 196 RAQRVLQRGLTRNPYSASLCQAWGLLELQKGNFLAAVRLLDKSVVYDPSFSPVLRWRQVI 17 R++ VLQ+ L NP S LCQAWGLLELQ+GN+ AA L++++V+ D S +PVL+WR V Sbjct: 390 RSRAVLQKALALNPSSPRLCQAWGLLELQRGNWTAASLLIERAVLLDASLAPVLKWRAVE 449 Query: 16 DAR 8 AR Sbjct: 450 TAR 452 >ref|XP_002948144.1| hypothetical protein VOLCADRAFT_88469 [Volvox carteri f. nagariensis] gi|300266364|gb|EFJ50551.1| hypothetical protein VOLCADRAFT_88469 [Volvox carteri f. nagariensis] Length = 139 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/65 (53%), Positives = 47/65 (72%) Frame = -1 Query: 196 RAQRVLQRGLTRNPYSASLCQAWGLLELQKGNFLAAVRLLDKSVVYDPSFSPVLRWRQVI 17 R + VLQRGL NP S+ L QAWGL+ELQ+GN+LAAV +L++S D PVLRW+ V Sbjct: 40 RCRAVLQRGLELNPSSSCLIQAWGLMELQRGNWLAAVMMLERSARLDDRCVPVLRWQHVK 99 Query: 16 DARSS 2 A+++ Sbjct: 100 TAKTT 104 >ref|XP_005851579.1| hypothetical protein CHLNCDRAFT_138082 [Chlorella variabilis] gi|307111242|gb|EFN59477.1| hypothetical protein CHLNCDRAFT_138082 [Chlorella variabilis] Length = 241 Score = 71.2 bits (173), Expect = 2e-10 Identities = 32/61 (52%), Positives = 44/61 (72%) Frame = -1 Query: 184 VLQRGLTRNPYSASLCQAWGLLELQKGNFLAAVRLLDKSVVYDPSFSPVLRWRQVIDARS 5 VLQRGL N + +L QAWGL+E+Q+GN L A+ LLD+S +P PVLRW+ V++AR Sbjct: 167 VLQRGLLHNRDAPALLQAWGLMEMQRGNLLGAILLLDRSAALEPRNRPVLRWKPVVEARQ 226 Query: 4 S 2 + Sbjct: 227 T 227