BLASTX nr result
ID: Cinnamomum23_contig00031806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00031806 (326 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHF99883.1| hypothetical protein F383_17304 [Gossypium arboreum] 70 4e-10 gb|KJB13556.1| hypothetical protein B456_002G080700 [Gossypium r... 70 7e-10 ref|XP_012464680.1| PREDICTED: probable leucine-rich repeat rece... 68 3e-09 gb|KJB48252.1| hypothetical protein B456_008G060300 [Gossypium r... 68 3e-09 ref|XP_012436775.1| PREDICTED: probable leucine-rich repeat rece... 68 3e-09 ref|XP_006836999.1| PREDICTED: probable leucine-rich repeat rece... 68 3e-09 ref|XP_007021109.1| Kinase superfamily protein isoform 4 [Theobr... 68 3e-09 ref|XP_011623244.1| PREDICTED: probable leucine-rich repeat rece... 67 4e-09 ref|XP_011048261.1| PREDICTED: probable leucine-rich repeat rece... 67 4e-09 ref|XP_011030902.1| PREDICTED: probable leucine-rich repeat rece... 67 4e-09 ref|XP_002316964.1| hypothetical protein POPTR_0011s13470g [Popu... 67 4e-09 ref|XP_006370597.1| hypothetical protein POPTR_0001s44100g [Popu... 67 4e-09 gb|ERN05758.1| hypothetical protein AMTR_s00006p00251640 [Ambore... 67 4e-09 ref|XP_006659101.1| PREDICTED: probable leucine-rich repeat rece... 67 5e-09 gb|KHN20448.1| Putative leucine-rich repeat receptor-like serine... 67 6e-09 gb|ACU22790.1| unknown [Glycine max] 67 6e-09 ref|NP_001239745.1| probable leucine-rich repeat receptor-like s... 67 6e-09 ref|XP_012851969.1| PREDICTED: LOW QUALITY PROTEIN: probable leu... 66 8e-09 gb|KJB13552.1| hypothetical protein B456_002G080700 [Gossypium r... 66 8e-09 ref|XP_011097937.1| PREDICTED: probable leucine-rich repeat rece... 66 8e-09 >gb|KHF99883.1| hypothetical protein F383_17304 [Gossypium arboreum] Length = 416 Score = 70.5 bits (171), Expect = 4e-10 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -3 Query: 141 LLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLY 22 LL RLHHRNLVNL GYC++KRQYML+Y +M+NGSL+T LY Sbjct: 163 LLGRLHHRNLVNLIGYCVDKRQYMLIYEFMSNGSLATILY 202 >gb|KJB13556.1| hypothetical protein B456_002G080700 [Gossypium raimondii] Length = 302 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 153 GKAQLLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLY 22 GK LL RLHHRNLVNL GYC EK Q+MLVY YM+ GSL++ LY Sbjct: 28 GKVMLLGRLHHRNLVNLVGYCAEKGQHMLVYVYMSKGSLASHLY 71 >ref|XP_012464680.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730 isoform X1 [Gossypium raimondii] gi|823263845|ref|XP_012464681.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730 isoform X1 [Gossypium raimondii] gi|823263847|ref|XP_012464682.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730 isoform X1 [Gossypium raimondii] gi|763814999|gb|KJB81851.1| hypothetical protein B456_013G164600 [Gossypium raimondii] Length = 436 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/48 (62%), Positives = 36/48 (75%) Frame = -3 Query: 150 KAQLLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLYRTFCC 7 + LL RLHHRNLVNL GYC EK Q+MLVY YM+ GSL++ LY + C Sbjct: 156 EVMLLGRLHHRNLVNLVGYCAEKGQHMLVYVYMSKGSLASHLYTSRLC 203 >gb|KJB48252.1| hypothetical protein B456_008G060300 [Gossypium raimondii] Length = 345 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 141 LLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLY 22 LL RLHHRNLVNL GYC++K QYML+Y +M+NGSL+T LY Sbjct: 163 LLGRLHHRNLVNLIGYCVDKGQYMLIYEFMSNGSLATILY 202 >ref|XP_012436775.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730 [Gossypium raimondii] gi|823205392|ref|XP_012436776.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730 [Gossypium raimondii] gi|763781180|gb|KJB48251.1| hypothetical protein B456_008G060300 [Gossypium raimondii] gi|763781182|gb|KJB48253.1| hypothetical protein B456_008G060300 [Gossypium raimondii] gi|763781183|gb|KJB48254.1| hypothetical protein B456_008G060300 [Gossypium raimondii] gi|763781184|gb|KJB48255.1| hypothetical protein B456_008G060300 [Gossypium raimondii] Length = 416 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 141 LLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLY 22 LL RLHHRNLVNL GYC++K QYML+Y +M+NGSL+T LY Sbjct: 163 LLGRLHHRNLVNLIGYCVDKGQYMLIYEFMSNGSLATILY 202 >ref|XP_006836999.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730 [Amborella trichopoda] gi|548839578|gb|ERM99852.1| hypothetical protein AMTR_s00098p00128430 [Amborella trichopoda] Length = 433 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 141 LLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLY 22 LL RLHHRNLVNL GYC EK Q+MLVY YM+NGSL++ LY Sbjct: 159 LLGRLHHRNLVNLVGYCAEKGQHMLVYVYMSNGSLASHLY 198 >ref|XP_007021109.1| Kinase superfamily protein isoform 4 [Theobroma cacao] gi|508720737|gb|EOY12634.1| Kinase superfamily protein isoform 4 [Theobroma cacao] Length = 304 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -3 Query: 150 KAQLLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLYR 19 + LL RLHHRNLVNL GYC EK Q+MLVY YM+ GSL++ LYR Sbjct: 156 EVMLLGRLHHRNLVNLVGYCAEKGQHMLVYVYMSKGSLASHLYR 199 >ref|XP_011623244.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730 [Amborella trichopoda] Length = 420 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -3 Query: 141 LLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLYRTFCC 7 LL RLHHRNLVNL GYC++K QYML+Y YM+NGSL++ L+ C Sbjct: 160 LLGRLHHRNLVNLVGYCVDKGQYMLLYEYMSNGSLASHLFSEGPC 204 >ref|XP_011048261.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730 [Populus euphratica] gi|743909557|ref|XP_011048262.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730 [Populus euphratica] gi|743909559|ref|XP_011048263.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730 [Populus euphratica] gi|743909561|ref|XP_011048264.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730 [Populus euphratica] Length = 431 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -3 Query: 150 KAQLLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLYR 19 + LL RLHHRNLVNL GYC EK Q+ML+Y YM+ GSL++ LYR Sbjct: 156 EVMLLGRLHHRNLVNLVGYCAEKGQHMLIYVYMSKGSLASHLYR 199 >ref|XP_011030902.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730 [Populus euphratica] Length = 430 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -3 Query: 150 KAQLLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLYR 19 + LL RLHHRNLVNL GYC EK Q+ML+Y YM+ GSL++ LYR Sbjct: 154 EVMLLGRLHHRNLVNLVGYCAEKGQHMLIYVYMSEGSLASHLYR 197 >ref|XP_002316964.1| hypothetical protein POPTR_0011s13470g [Populus trichocarpa] gi|222860029|gb|EEE97576.1| hypothetical protein POPTR_0011s13470g [Populus trichocarpa] Length = 430 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -3 Query: 150 KAQLLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLYR 19 + LL RLHHRNLVNL GYC EK Q+ML+Y YM+ GSL++ LYR Sbjct: 154 EVMLLGRLHHRNLVNLVGYCAEKGQHMLIYVYMSEGSLASHLYR 197 >ref|XP_006370597.1| hypothetical protein POPTR_0001s44100g [Populus trichocarpa] gi|550349803|gb|ERP67166.1| hypothetical protein POPTR_0001s44100g [Populus trichocarpa] Length = 428 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -3 Query: 150 KAQLLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLYR 19 + LL RLHHRNLVNL GYC EK Q+ML+Y YM+ GSL++ LYR Sbjct: 156 EVMLLGRLHHRNLVNLVGYCAEKGQHMLIYVYMSKGSLASHLYR 199 >gb|ERN05758.1| hypothetical protein AMTR_s00006p00251640 [Amborella trichopoda] Length = 545 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -3 Query: 141 LLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLYRTFCC 7 LL RLHHRNLVNL GYC++K QYML+Y YM+NGSL++ L+ C Sbjct: 285 LLGRLHHRNLVNLVGYCVDKGQYMLLYEYMSNGSLASHLFSEGPC 329 >ref|XP_006659101.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730-like [Oryza brachyantha] Length = 434 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 141 LLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLY 22 LL RLHHRNLVNL GYC EK Q+ML+YAYM NGSL++ LY Sbjct: 162 LLGRLHHRNLVNLVGYCAEKGQHMLLYAYMPNGSLASHLY 201 >gb|KHN20448.1| Putative leucine-rich repeat receptor-like serine/threonine-protein kinase [Glycine soja] Length = 429 Score = 66.6 bits (161), Expect = 6e-09 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 150 KAQLLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLY 22 + LL RLHHRNLVNL GYC EK Q MLVY YM+NGSL++ LY Sbjct: 157 EVMLLGRLHHRNLVNLVGYCAEKGQRMLVYVYMSNGSLASHLY 199 >gb|ACU22790.1| unknown [Glycine max] Length = 429 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 150 KAQLLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLY 22 + LL RLHHRNLVNL GYC EK ++MLVY YM+NGSL++ LY Sbjct: 157 EVMLLGRLHHRNLVNLVGYCAEKGKHMLVYVYMSNGSLASHLY 199 >ref|NP_001239745.1| probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730-like [Glycine max] gi|571458011|ref|XP_006580994.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730-like isoform X1 [Glycine max] gi|571458013|ref|XP_006580995.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730-like isoform X2 [Glycine max] gi|571458015|ref|XP_006580996.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730-like isoform X3 [Glycine max] gi|571458017|ref|XP_006580997.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730-like isoform X4 [Glycine max] gi|571458019|ref|XP_006580998.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730-like isoform X5 [Glycine max] gi|223452385|gb|ACM89520.1| serine/threonine protein kinase [Glycine max] gi|734425398|gb|KHN43092.1| Putative leucine-rich repeat receptor-like serine/threonine-protein kinase [Glycine soja] Length = 430 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 150 KAQLLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLY 22 + LL RLHHRNLVNL GYC EK ++MLVY YM+NGSL++ LY Sbjct: 158 EVMLLGRLHHRNLVNLVGYCAEKGKHMLVYVYMSNGSLASHLY 200 >ref|XP_012851969.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730 [Erythranthe guttatus] Length = 430 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 150 KAQLLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLY 22 + LL RLHHRNLVNL GYCI+K Q+MLVY YM+NGSL LY Sbjct: 168 EVSLLGRLHHRNLVNLVGYCIDKGQHMLVYEYMSNGSLRKLLY 210 >gb|KJB13552.1| hypothetical protein B456_002G080700 [Gossypium raimondii] Length = 211 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = -3 Query: 150 KAQLLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLYRTF 13 + LL RLHHRNLVNL GYC EK Q+MLVY YM+ GSL++ LY + Sbjct: 156 EVMLLGRLHHRNLVNLVGYCAEKGQHMLVYVYMSKGSLASHLYSKY 201 >ref|XP_011097937.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730 [Sesamum indicum] gi|747099758|ref|XP_011097938.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730 [Sesamum indicum] gi|747099760|ref|XP_011097939.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730 [Sesamum indicum] Length = 430 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 150 KAQLLARLHHRNLVNLAGYCIEKRQYMLVYAYMNNGSLSTQLY 22 + LL RLHHRNLVNL GYC EK Q+ML+Y YM+ GSL++ LY Sbjct: 156 EVMLLGRLHHRNLVNLVGYCAEKNQHMLIYVYMSRGSLASHLY 198