BLASTX nr result
ID: Cinnamomum23_contig00031441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00031441 (312 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007678652.1| hypothetical protein BAUCODRAFT_36548 [Baudo... 65 2e-08 gb|EMF13133.1| Annexin [Sphaerulina musiva SO2202] 63 9e-08 gb|KJY00558.1| annexin like protein [Zymoseptoria brevis] 59 1e-06 ref|XP_003853976.1| hypothetical protein MYCGRDRAFT_70190 [Zymos... 59 1e-06 ref|XP_007925121.1| hypothetical protein MYCFIDRAFT_163304 [Pseu... 58 2e-06 >ref|XP_007678652.1| hypothetical protein BAUCODRAFT_36548 [Baudoinia compniacensis UAMH 10762] gi|449298056|gb|EMC94073.1| hypothetical protein BAUCODRAFT_36548 [Baudoinia compniacensis UAMH 10762] Length = 450 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -1 Query: 312 LHQCKAAYKHFHHQDLAQRIRGETSGDYEKLMVECITPLHARGAY 178 L QCKAAYKHF+ +DLA+RIR ET GDYEKLM+ CI+ G Y Sbjct: 406 LQQCKAAYKHFYKRDLAERIRSETRGDYEKLMLACISATPPTGGY 450 >gb|EMF13133.1| Annexin [Sphaerulina musiva SO2202] Length = 449 Score = 62.8 bits (151), Expect = 9e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 312 LHQCKAAYKHFHHQDLAQRIRGETSGDYEKLMVECI 205 LHQCKAAYKHF+ +DLA RI ETSGDY+KLMV C+ Sbjct: 413 LHQCKAAYKHFYKKDLAARIASETSGDYKKLMVACV 448 >gb|KJY00558.1| annexin like protein [Zymoseptoria brevis] Length = 440 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = -1 Query: 312 LHQCKAAYKHFHHQDLAQRIRGETSGDYEKLMVECIT 202 L QCKAAYKHF+ +DL +RI+ ETSGDY+KLM C++ Sbjct: 402 LQQCKAAYKHFYKRDLVERIKSETSGDYKKLMAVCVS 438 >ref|XP_003853976.1| hypothetical protein MYCGRDRAFT_70190 [Zymoseptoria tritici IPO323] gi|339473859|gb|EGP88952.1| hypothetical protein MYCGRDRAFT_70190 [Zymoseptoria tritici IPO323] Length = 447 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = -1 Query: 312 LHQCKAAYKHFHHQDLAQRIRGETSGDYEKLMVECIT 202 L QCKAAYKHF+ +DL +RI+ ETSGDY+KLM C++ Sbjct: 409 LQQCKAAYKHFYKRDLVERIKSETSGDYKKLMAVCVS 445 >ref|XP_007925121.1| hypothetical protein MYCFIDRAFT_163304 [Pseudocercospora fijiensis CIRAD86] gi|452984740|gb|EME84497.1| hypothetical protein MYCFIDRAFT_163304 [Pseudocercospora fijiensis CIRAD86] Length = 398 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -1 Query: 312 LHQCKAAYKHFHHQDLAQRIRGETSGDYEKLMVECI 205 L Q KAAYKHF+ +DLA+RI+ ETSGDY+KLMV C+ Sbjct: 359 LQQAKAAYKHFYKRDLAERIKSETSGDYKKLMVVCV 394