BLASTX nr result
ID: Cinnamomum23_contig00031294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00031294 (383 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010272779.1| PREDICTED: F-box/LRR-repeat protein At4g1410... 73 9e-11 ref|XP_010272778.1| PREDICTED: F-box/LRR-repeat protein At4g1410... 73 9e-11 ref|XP_009370827.1| PREDICTED: putative FBD-associated F-box pro... 73 9e-11 ref|XP_009370735.1| PREDICTED: FBD-associated F-box protein At4g... 73 9e-11 ref|XP_008368607.1| PREDICTED: FBD-associated F-box protein At4g... 73 9e-11 ref|XP_007023466.1| F-box/RNI-like superfamily protein [Theobrom... 70 7e-10 ref|XP_009344632.1| PREDICTED: putative F-box/LRR-repeat protein... 68 2e-09 ref|XP_009344628.1| PREDICTED: F-box/LRR-repeat protein At3g5890... 68 2e-09 ref|XP_010267730.1| PREDICTED: F-box protein At4g09920 [Nelumbo ... 67 4e-09 ref|XP_011465565.1| PREDICTED: putative FBD-associated F-box pro... 67 5e-09 ref|XP_010277954.1| PREDICTED: F-box/LRR-repeat protein At4g1410... 66 1e-08 ref|XP_010268835.1| PREDICTED: F-box/LRR-repeat protein 25-like ... 66 1e-08 ref|XP_011465564.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g... 65 1e-08 ref|XP_011465563.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g... 65 1e-08 ref|XP_010450920.1| PREDICTED: putative F-box protein At5g38390 ... 65 2e-08 gb|KHN10564.1| F-box/FBD/LRR-repeat protein, partial [Glycine soja] 64 3e-08 ref|XP_009795825.1| PREDICTED: putative F-box protein At1g49610 ... 64 3e-08 ref|XP_009795820.1| PREDICTED: putative F-box protein At1g49610 ... 64 3e-08 ref|XP_010059413.1| PREDICTED: F-box protein At5g03100-like [Euc... 64 4e-08 emb|CDP11355.1| unnamed protein product [Coffea canephora] 64 4e-08 >ref|XP_010272779.1| PREDICTED: F-box/LRR-repeat protein At4g14103-like isoform X2 [Nelumbo nucifera] Length = 456 Score = 72.8 bits (177), Expect = 9e-11 Identities = 37/86 (43%), Positives = 54/86 (62%), Gaps = 4/86 (4%) Frame = -1 Query: 251 DRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNLHFHS----PANSDFEDC 84 DRL+SLP++++HHILSFLD+++VV + LSRRWR L S+PNL F ++ Sbjct: 28 DRLSSLPEKILHHILSFLDMRYVVRTSFLSRRWRYLWTSLPNLEFDHLYFLSRTGGRDEA 87 Query: 83 DFDFIRLVDRALLFSSAPKINKLQLS 6 + F+ VDR LL ++ I K +S Sbjct: 88 ENGFMDFVDRVLLLRNSSDIQKFHIS 113 >ref|XP_010272778.1| PREDICTED: F-box/LRR-repeat protein At4g14103-like isoform X1 [Nelumbo nucifera] Length = 498 Score = 72.8 bits (177), Expect = 9e-11 Identities = 37/86 (43%), Positives = 54/86 (62%), Gaps = 4/86 (4%) Frame = -1 Query: 251 DRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNLHFHS----PANSDFEDC 84 DRL+SLP++++HHILSFLD+++VV + LSRRWR L S+PNL F ++ Sbjct: 28 DRLSSLPEKILHHILSFLDMRYVVRTSFLSRRWRYLWTSLPNLEFDHLYFLSRTGGRDEA 87 Query: 83 DFDFIRLVDRALLFSSAPKINKLQLS 6 + F+ VDR LL ++ I K +S Sbjct: 88 ENGFMDFVDRVLLLRNSSDIQKFHIS 113 >ref|XP_009370827.1| PREDICTED: putative FBD-associated F-box protein At3g50710 [Pyrus x bretschneideri] Length = 356 Score = 72.8 bits (177), Expect = 9e-11 Identities = 43/100 (43%), Positives = 54/100 (54%), Gaps = 6/100 (6%) Frame = -1 Query: 287 MEMILAERRSKVDRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNLHFHSP 108 M ++L R DR+ +LPD L+ HILSFL K+ V ILSRRW+ L SVPNL+F+ Sbjct: 1 MSLVLKRRAKVKDRINALPDALLCHILSFLPTKYAVRTTILSRRWKNLWTSVPNLYFND- 59 Query: 107 ANSDFEDCDFD------FIRLVDRALLFSSAPKINKLQLS 6 DF F R VDR L F + I K +LS Sbjct: 60 -RKDFPSFQAGPYGSNLFTRFVDRVLYFRDSSDIKKFRLS 98 >ref|XP_009370735.1| PREDICTED: FBD-associated F-box protein At4g10400-like isoform X1 [Pyrus x bretschneideri] Length = 439 Score = 72.8 bits (177), Expect = 9e-11 Identities = 43/100 (43%), Positives = 54/100 (54%), Gaps = 6/100 (6%) Frame = -1 Query: 287 MEMILAERRSKVDRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNLHFHSP 108 M ++L R DR+ +LPD L+ HILSFL K+ V ILSRRW+ L SVPNL+F+ Sbjct: 1 MSLVLKRRAKVKDRINALPDALLCHILSFLPTKYAVRTTILSRRWKNLWTSVPNLYFND- 59 Query: 107 ANSDFEDCDFD------FIRLVDRALLFSSAPKINKLQLS 6 DF F R VDR L F + I K +LS Sbjct: 60 -RKDFPSFQAGPYGSNLFTRFVDRVLYFRDSSDIKKFRLS 98 >ref|XP_008368607.1| PREDICTED: FBD-associated F-box protein At4g10400-like [Malus domestica] Length = 439 Score = 72.8 bits (177), Expect = 9e-11 Identities = 43/100 (43%), Positives = 54/100 (54%), Gaps = 6/100 (6%) Frame = -1 Query: 287 MEMILAERRSKVDRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNLHFHSP 108 M ++L R DR+ +LPD L+ HILSFL K+ V ILSRRW+ L SVPNL+F+ Sbjct: 1 MSLVLKRRAKVKDRINALPDALLCHILSFLPTKYAVRTTILSRRWKNLWTSVPNLYFND- 59 Query: 107 ANSDFEDCDFD------FIRLVDRALLFSSAPKINKLQLS 6 DF F R VDR L F + I K +LS Sbjct: 60 -RKDFPSFQAGPYGSNLFTRFVDRVLYFRDSSDIKKFRLS 98 >ref|XP_007023466.1| F-box/RNI-like superfamily protein [Theobroma cacao] gi|508778832|gb|EOY26088.1| F-box/RNI-like superfamily protein [Theobroma cacao] Length = 489 Score = 69.7 bits (169), Expect = 7e-10 Identities = 38/93 (40%), Positives = 54/93 (58%) Frame = -1 Query: 287 MEMILAERRSKVDRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNLHFHSP 108 M ++ + +DRL+ LPD +I HILS L K+ V ++LS RWR LS SV L F+ Sbjct: 1 MAKLVKHEGNNIDRLSGLPDSIISHILSLLPTKYAVRTSVLSTRWRFLSTSVSTLDFY-- 58 Query: 107 ANSDFEDCDFDFIRLVDRALLFSSAPKINKLQL 9 D+E+ F+ VDR LLF +A I + +L Sbjct: 59 ---DYENPSERFMNFVDRVLLFHNAACIKRFRL 88 >ref|XP_009344632.1| PREDICTED: putative F-box/LRR-repeat protein At4g13960 isoform X2 [Pyrus x bretschneideri] Length = 385 Score = 68.2 bits (165), Expect = 2e-09 Identities = 40/101 (39%), Positives = 53/101 (52%), Gaps = 7/101 (6%) Frame = -1 Query: 287 MEMILAERRSKVDRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNLHF--H 114 M I + S DR++ LPD ++ H+LSFL+ H V +LS RW L VPNLHF + Sbjct: 1 MGSISDHQASVEDRISELPDTILCHVLSFLETVHAVRTTVLSTRWNNLWTKVPNLHFDYY 60 Query: 113 SPANSDFEDCDFD-----FIRLVDRALLFSSAPKINKLQLS 6 + +ED D D F+ VDR L F + KI LS Sbjct: 61 PSFSPKYEDEDADVCRNHFMTFVDRVLFFRDSSKIQNFTLS 101 >ref|XP_009344628.1| PREDICTED: F-box/LRR-repeat protein At3g58900-like isoform X1 [Pyrus x bretschneideri] gi|694434853|ref|XP_009344629.1| PREDICTED: F-box/LRR-repeat protein At3g58900-like isoform X1 [Pyrus x bretschneideri] gi|694434855|ref|XP_009344631.1| PREDICTED: F-box/LRR-repeat protein At3g58900-like isoform X1 [Pyrus x bretschneideri] Length = 455 Score = 68.2 bits (165), Expect = 2e-09 Identities = 40/101 (39%), Positives = 53/101 (52%), Gaps = 7/101 (6%) Frame = -1 Query: 287 MEMILAERRSKVDRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNLHF--H 114 M I + S DR++ LPD ++ H+LSFL+ H V +LS RW L VPNLHF + Sbjct: 1 MGSISDHQASVEDRISELPDTILCHVLSFLETVHAVRTTVLSTRWNNLWTKVPNLHFDYY 60 Query: 113 SPANSDFEDCDFD-----FIRLVDRALLFSSAPKINKLQLS 6 + +ED D D F+ VDR L F + KI LS Sbjct: 61 PSFSPKYEDEDADVCRNHFMTFVDRVLFFRDSSKIQNFTLS 101 >ref|XP_010267730.1| PREDICTED: F-box protein At4g09920 [Nelumbo nucifera] Length = 451 Score = 67.4 bits (163), Expect = 4e-09 Identities = 38/91 (41%), Positives = 50/91 (54%) Frame = -1 Query: 275 LAERRSKVDRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNLHFHSPANSD 96 L +R DR++ LPD +I HILSFL +K V+ + LS+RW+ L SVPNL F S Sbjct: 4 LGNQRESCDRISELPDSVIQHILSFLPVKDVIRTSFLSKRWKYLWTSVPNLDFDGLVFSP 63 Query: 95 FEDCDFDFIRLVDRALLFSSAPKINKLQLSF 3 F+ VD LL + I K +LSF Sbjct: 64 ----KTKFMNFVDSVLLRRNGAAIQKFRLSF 90 >ref|XP_011465565.1| PREDICTED: putative FBD-associated F-box protein At3g50710 [Fragaria vesca subsp. vesca] Length = 450 Score = 67.0 bits (162), Expect = 5e-09 Identities = 34/86 (39%), Positives = 50/86 (58%) Frame = -1 Query: 266 RRSKVDRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNLHFHSPANSDFED 87 +R DR+++LPD +++HILSFL + +V+ LSRRW+ + ASVP+L F N D Sbjct: 7 KRVNRDRISALPDAILYHILSFLKTEDIVMTIFLSRRWKNIWASVPSLDFCDEENPD--- 63 Query: 86 CDFDFIRLVDRALLFSSAPKINKLQL 9 F R +D L F + I K +L Sbjct: 64 -TISFSRFIDNVLFFRDSTDIQKFRL 88 >ref|XP_010277954.1| PREDICTED: F-box/LRR-repeat protein At4g14103-like [Nelumbo nucifera] Length = 528 Score = 65.9 bits (159), Expect = 1e-08 Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 7/89 (7%) Frame = -1 Query: 251 DRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNLHFH-------SPANSDF 93 DR++ LPD ++HHILSF D K+ V +ILS+RW+ + S+P L+F P + Sbjct: 24 DRISGLPDTILHHILSFTDTKYAVQTSILSKRWKHVWTSLPYLNFDQNLFWEPKPVRGEE 83 Query: 92 EDCDFDFIRLVDRALLFSSAPKINKLQLS 6 + F+ VDR LLF + K QLS Sbjct: 84 DRRTNRFMDFVDRVLLFRDGSNVLKFQLS 112 >ref|XP_010268835.1| PREDICTED: F-box/LRR-repeat protein 25-like [Nelumbo nucifera] Length = 398 Score = 65.9 bits (159), Expect = 1e-08 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 8/88 (9%) Frame = -1 Query: 251 DRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNL-------HFHSPANSDF 93 DRL++LPD LIHHILSF+D + V ++LSRRWR L S+P L HF +P + Sbjct: 31 DRLSNLPDNLIHHILSFMDTIYAVRTSVLSRRWRHLWTSIPCLSFDVDIMHFATPDEPEI 90 Query: 92 EDCDFD-FIRLVDRALLFSSAPKINKLQ 12 + ++D F+ LVD L+ I K + Sbjct: 91 YEGEWDHFMDLVDEILIRRDGSDIRKFR 118 >ref|XP_011465564.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g56420-like isoform X2 [Fragaria vesca subsp. vesca] Length = 480 Score = 65.5 bits (158), Expect = 1e-08 Identities = 37/93 (39%), Positives = 55/93 (59%) Frame = -1 Query: 287 MEMILAERRSKVDRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNLHFHSP 108 M + A+R +K DR+++LPD +++HILSFL + VV LSRRW+ + ASVP+L F Sbjct: 1 MSEVEAKRVNK-DRISALPDAILYHILSFLTTEDVVTTIFLSRRWKKIWASVPSLDFCDH 59 Query: 107 ANSDFEDCDFDFIRLVDRALLFSSAPKINKLQL 9 N + F R +D L F + I+K +L Sbjct: 60 ENPE----TIPFSRFIDNVLFFRDSTDIHKFRL 88 >ref|XP_011465563.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g56420-like isoform X1 [Fragaria vesca subsp. vesca] Length = 489 Score = 65.5 bits (158), Expect = 1e-08 Identities = 37/93 (39%), Positives = 55/93 (59%) Frame = -1 Query: 287 MEMILAERRSKVDRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNLHFHSP 108 M + A+R +K DR+++LPD +++HILSFL + VV LSRRW+ + ASVP+L F Sbjct: 1 MSEVEAKRVNK-DRISALPDAILYHILSFLTTEDVVTTIFLSRRWKKIWASVPSLDFCDH 59 Query: 107 ANSDFEDCDFDFIRLVDRALLFSSAPKINKLQL 9 N + F R +D L F + I+K +L Sbjct: 60 ENPE----TIPFSRFIDNVLFFRDSTDIHKFRL 88 >ref|XP_010450920.1| PREDICTED: putative F-box protein At5g38390 [Camelina sativa] Length = 478 Score = 65.1 bits (157), Expect = 2e-08 Identities = 36/84 (42%), Positives = 46/84 (54%), Gaps = 2/84 (2%) Frame = -1 Query: 254 VDRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNLHFHSPANSDFEDCDF- 78 +D L +LP+ ++ HILSFL K L ++LS+RWR L A VPNLH +DCDF Sbjct: 1 MDLLNNLPEEILCHILSFLTTKEAALTSVLSKRWRNLFAFVPNLH--------IDDCDFR 52 Query: 77 -DFIRLVDRALLFSSAPKINKLQL 9 F+ VDR L I K L Sbjct: 53 QSFMEFVDRVLALQGNSPIKKFYL 76 >gb|KHN10564.1| F-box/FBD/LRR-repeat protein, partial [Glycine soja] Length = 385 Score = 64.3 bits (155), Expect = 3e-08 Identities = 33/77 (42%), Positives = 48/77 (62%) Frame = -1 Query: 275 LAERRSKVDRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNLHFHSPANSD 96 L E R+ DR++SLPD L+ HILSFL V ++LS+RWR L SVP+LHF+ Sbjct: 8 LLECRTMADRISSLPDTLLCHILSFLPTIESVATSVLSKRWRPLWRSVPSLHFNDQIYWQ 67 Query: 95 FEDCDFDFIRLVDRALL 45 + + + F++LV +L Sbjct: 68 YGETYYRFVQLVYTVML 84 >ref|XP_009795825.1| PREDICTED: putative F-box protein At1g49610 isoform X2 [Nicotiana sylvestris] Length = 439 Score = 64.3 bits (155), Expect = 3e-08 Identities = 35/86 (40%), Positives = 55/86 (63%), Gaps = 4/86 (4%) Frame = -1 Query: 254 VDRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNLHFHSPANSDFEDCDF- 78 +DRL+ LP+R++ HILSF++++ +V AILS+ WR L ++VPNL DF D DF Sbjct: 1 MDRLSELPERILVHILSFVNMRDLVRTAILSKHWRHLWSTVPNL--------DFSDDDFY 52 Query: 77 ---DFIRLVDRALLFSSAPKINKLQL 9 +++ V+R LL KI +L++ Sbjct: 53 PYQNYVDFVNRTLLSRGTSKIRRLKI 78 >ref|XP_009795820.1| PREDICTED: putative F-box protein At1g49610 isoform X1 [Nicotiana sylvestris] gi|698500083|ref|XP_009795821.1| PREDICTED: putative F-box protein At1g49610 isoform X1 [Nicotiana sylvestris] gi|698500085|ref|XP_009795822.1| PREDICTED: putative F-box protein At1g49610 isoform X1 [Nicotiana sylvestris] gi|698500087|ref|XP_009795823.1| PREDICTED: putative F-box protein At1g49610 isoform X1 [Nicotiana sylvestris] gi|698500089|ref|XP_009795824.1| PREDICTED: putative F-box protein At1g49610 isoform X1 [Nicotiana sylvestris] Length = 452 Score = 64.3 bits (155), Expect = 3e-08 Identities = 35/86 (40%), Positives = 55/86 (63%), Gaps = 4/86 (4%) Frame = -1 Query: 254 VDRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNLHFHSPANSDFEDCDF- 78 +DRL+ LP+R++ HILSF++++ +V AILS+ WR L ++VPNL DF D DF Sbjct: 1 MDRLSELPERILVHILSFVNMRDLVRTAILSKHWRHLWSTVPNL--------DFSDDDFY 52 Query: 77 ---DFIRLVDRALLFSSAPKINKLQL 9 +++ V+R LL KI +L++ Sbjct: 53 PYQNYVDFVNRTLLSRGTSKIRRLKI 78 >ref|XP_010059413.1| PREDICTED: F-box protein At5g03100-like [Eucalyptus grandis] Length = 322 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/82 (36%), Positives = 48/82 (58%) Frame = -1 Query: 251 DRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNLHFHSPANSDFEDCDFDF 72 D +++LPD +IHHI SFL +K V+ ++LS+RWR S +L F+ + + FDF Sbjct: 31 DLISALPDAMIHHIFSFLPLKDVIKTSVLSKRWRCTWTSTTHLAFNGVRPRNHDASSFDF 90 Query: 71 IRLVDRALLFSSAPKINKLQLS 6 LVD L ++P + K ++ Sbjct: 91 PSLVDSVLRQCTSPTVKKFHVT 112 >emb|CDP11355.1| unnamed protein product [Coffea canephora] Length = 465 Score = 63.9 bits (154), Expect = 4e-08 Identities = 36/84 (42%), Positives = 50/84 (59%), Gaps = 6/84 (7%) Frame = -1 Query: 266 RRSKVDRLTSLPDRLIHHILSFLDIKHVVLAAILSRRWRALSASVPNLHFHSPANSDFED 87 RR K DRL++LPD ++ HILSFL +K+VV +ILS RW+ L SVP + +S E+ Sbjct: 10 RRQKYDRLSALPDAVLCHILSFLPMKYVVATSILSTRWKYLYMSVPVIKLDDTVHSQEEE 69 Query: 86 CDFD------FIRLVDRALLFSSA 33 D F R +DR L+ +A Sbjct: 70 ESQDNIRSDSFRRFIDRVLMLRNA 93