BLASTX nr result
ID: Cinnamomum23_contig00030477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00030477 (258 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33969.1| hypothetical protein MIMGU_mgv1a018275mg [Erythra... 57 4e-06 >gb|EYU33969.1| hypothetical protein MIMGU_mgv1a018275mg [Erythranthe guttata] Length = 152 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/41 (60%), Positives = 27/41 (65%) Frame = +2 Query: 134 DPAWSFGEAVENNRLKIKCKFCGKVTNGGITRFKHHLGHIS 256 D W FG+ V NR KIKCK C VT GGITR K H+ HIS Sbjct: 6 DIGWDFGDMVGENRKKIKCKLCQVVTTGGITRLKQHIAHIS 46