BLASTX nr result
ID: Cinnamomum23_contig00030315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00030315 (319 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN73734.1| hypothetical protein VITISV_032119 [Vitis vinifera] 61 3e-07 ref|XP_007199279.1| hypothetical protein PRUPE_ppa022873mg [Prun... 59 2e-06 >emb|CAN73734.1| hypothetical protein VITISV_032119 [Vitis vinifera] Length = 917 Score = 60.8 bits (146), Expect = 3e-07 Identities = 32/72 (44%), Positives = 46/72 (63%), Gaps = 1/72 (1%) Frame = +3 Query: 105 KFCLTKTN*R-RLDA*RCNVKFNEGDTVMVQMKLERFPPGTYKMQHPWSTSLLKILKKIR 281 K L+ N + + D R V F EGD +MV+++LER+P GTYK H + S ++LKKI Sbjct: 562 KIALSNENYKAQADLKRKFVDFKEGDMIMVRIRLERYPKGTYKKLHSKNVSPYRVLKKIS 621 Query: 282 YNSYVFDLPSDM 317 N++V DLP +M Sbjct: 622 TNAHVIDLPENM 633 >ref|XP_007199279.1| hypothetical protein PRUPE_ppa022873mg [Prunus persica] gi|462394679|gb|EMJ00478.1| hypothetical protein PRUPE_ppa022873mg [Prunus persica] Length = 777 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/51 (56%), Positives = 33/51 (64%) Frame = +3 Query: 165 FNEGDTVMVQMKLERFPPGTYKMQHPWSTSLLKILKKIRYNSYVFDLPSDM 317 FNEGD +MV +K ERFP GTY+ P KILKKI N+YV DLP M Sbjct: 645 FNEGDFIMVYLKNERFPMGTYRKLQPHKYGPSKILKKINDNAYVVDLPHSM 695