BLASTX nr result
ID: Cinnamomum23_contig00030197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00030197 (523 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010101957.1| NAD(P)H-quinone oxidoreductase subunit L [Mo... 57 6e-06 ref|XP_011075443.1| PREDICTED: uncharacterized protein LOC105159... 57 6e-06 >ref|XP_010101957.1| NAD(P)H-quinone oxidoreductase subunit L [Morus notabilis] gi|587902642|gb|EXB90881.1| NAD(P)H-quinone oxidoreductase subunit L [Morus notabilis] Length = 188 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/52 (48%), Positives = 38/52 (73%) Frame = -1 Query: 157 VDIFLISNFDFLIIFSCFWGKSQPVILNWMRLRFYKRNLLETYVQFMFVFMF 2 + + +++ F FL++ P+I+NW+R+R+YKRNLLETY QFMFVF+F Sbjct: 94 IQLGVVAFFYFLVM--------PPIIMNWLRIRWYKRNLLETYFQFMFVFIF 137 >ref|XP_011075443.1| PREDICTED: uncharacterized protein LOC105159914 [Sesamum indicum] Length = 199 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = -1 Query: 142 ISNFDFLIIFSCFWGKSQPVILNWMRLRFYKRNLLETYVQFMFVFMF 2 IS F + I+F P+I+NW+R R+YKRNLLE YVQFMFVF+F Sbjct: 109 ISAFLYFIVFP-------PIIMNWLRTRWYKRNLLEMYVQFMFVFIF 148