BLASTX nr result
ID: Cinnamomum23_contig00030140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00030140 (249 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009348813.1| PREDICTED: pentatricopeptide repeat-containi... 99 8e-19 ref|XP_008350091.1| PREDICTED: pentatricopeptide repeat-containi... 99 8e-19 ref|XP_008386694.1| PREDICTED: pentatricopeptide repeat-containi... 99 8e-19 ref|XP_010260127.1| PREDICTED: pentatricopeptide repeat-containi... 97 5e-18 ref|XP_008218306.1| PREDICTED: pentatricopeptide repeat-containi... 96 7e-18 ref|XP_007206274.1| hypothetical protein PRUPE_ppa016070mg [Prun... 96 1e-17 ref|XP_009364458.1| PREDICTED: pentatricopeptide repeat-containi... 95 2e-17 ref|XP_008235102.1| PREDICTED: pentatricopeptide repeat-containi... 95 2e-17 ref|XP_007201172.1| hypothetical protein PRUPE_ppa003481mg [Prun... 95 2e-17 ref|XP_010660114.1| PREDICTED: pentatricopeptide repeat-containi... 94 4e-17 ref|XP_006476888.1| PREDICTED: pentatricopeptide repeat-containi... 94 4e-17 emb|CAN80796.1| hypothetical protein VITISV_034275 [Vitis vinifera] 94 4e-17 ref|XP_011624250.1| PREDICTED: pentatricopeptide repeat-containi... 93 6e-17 ref|XP_009373739.1| PREDICTED: pentatricopeptide repeat-containi... 93 6e-17 ref|XP_008341824.1| PREDICTED: pentatricopeptide repeat-containi... 93 6e-17 gb|EEC84744.1| hypothetical protein OsI_31741 [Oryza sativa Indi... 93 6e-17 ref|XP_010685827.1| PREDICTED: pentatricopeptide repeat-containi... 93 8e-17 ref|XP_010276442.1| PREDICTED: pentatricopeptide repeat-containi... 93 8e-17 ref|XP_008388704.1| PREDICTED: pentatricopeptide repeat-containi... 93 8e-17 ref|XP_010241372.1| PREDICTED: pentatricopeptide repeat-containi... 92 1e-16 >ref|XP_009348813.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890 [Pyrus x bretschneideri] Length = 571 Score = 99.4 bits (246), Expect = 8e-19 Identities = 43/62 (69%), Positives = 47/62 (75%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AF LKTS PIRI KNLRIC DCHDAMK ISE +GR +++RDC RFH FR G CSC D Sbjct: 510 AFCFLKTSPGTPIRIVKNLRICRDCHDAMKMISEEFGRQIVIRDCNRFHHFREGLCSCKD 569 Query: 69 YW 64 YW Sbjct: 570 YW 571 >ref|XP_008350091.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Malus domestica] gi|658058172|ref|XP_008364884.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Malus domestica] Length = 571 Score = 99.4 bits (246), Expect = 8e-19 Identities = 43/62 (69%), Positives = 47/62 (75%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AF LKTS PIRI KNLRIC DCHDAMK ISE +GR +++RDC RFH FR G CSC D Sbjct: 510 AFCFLKTSXGTPIRIVKNLRICRDCHDAMKMISEEFGREIVIRDCNRFHHFREGLCSCKD 569 Query: 69 YW 64 YW Sbjct: 570 YW 571 >ref|XP_008386694.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Malus domestica] Length = 157 Score = 99.4 bits (246), Expect = 8e-19 Identities = 43/62 (69%), Positives = 47/62 (75%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AF LKTS PIRI KNLRIC DCHDAMK ISE +GR +++RDC RFH FR G CSC D Sbjct: 96 AFCFLKTSLGTPIRIVKNLRICRDCHDAMKMISEEFGREIVIRDCNRFHHFREGLCSCKD 155 Query: 69 YW 64 YW Sbjct: 156 YW 157 >ref|XP_010260127.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Nelumbo nucifera] Length = 651 Score = 96.7 bits (239), Expect = 5e-18 Identities = 39/62 (62%), Positives = 50/62 (80%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AFGLLK S + PIR+ KNLR+C DCH A+K +S+ YGR +++RDC RFH FR G+CSCND Sbjct: 590 AFGLLKLSTNKPIRVVKNLRVCRDCHLAIKLMSQVYGREIVLRDCNRFHHFRDGRCSCND 649 Query: 69 YW 64 +W Sbjct: 650 FW 651 >ref|XP_008218306.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Prunus mume] Length = 802 Score = 96.3 bits (238), Expect = 7e-18 Identities = 42/62 (67%), Positives = 49/62 (79%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AFGL+ ++A MPIRI KNLR+CEDCH A K +S+ YGRV+IVRD RFH FR G CSC D Sbjct: 741 AFGLISSAAGMPIRIVKNLRVCEDCHTATKLLSKIYGRVMIVRDRNRFHHFRDGYCSCGD 800 Query: 69 YW 64 YW Sbjct: 801 YW 802 >ref|XP_007206274.1| hypothetical protein PRUPE_ppa016070mg [Prunus persica] gi|462401916|gb|EMJ07473.1| hypothetical protein PRUPE_ppa016070mg [Prunus persica] Length = 608 Score = 95.5 bits (236), Expect = 1e-17 Identities = 42/62 (67%), Positives = 48/62 (77%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AFGL+ T+A PIRI KNLR+CEDCH A K +S+ YGRV+IVRD RFH FR G CSC D Sbjct: 547 AFGLISTAAGTPIRIVKNLRVCEDCHTATKLLSKIYGRVMIVRDRNRFHHFRDGYCSCGD 606 Query: 69 YW 64 YW Sbjct: 607 YW 608 >ref|XP_009364458.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Pyrus x bretschneideri] Length = 828 Score = 95.1 bits (235), Expect = 2e-17 Identities = 40/62 (64%), Positives = 48/62 (77%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AFGL+ T+A PIR+ KNLR+C+DCH A K +S+ YGRV+IVRD RFH FR G CSC D Sbjct: 767 AFGLIATAAGTPIRVVKNLRVCDDCHTATKLLSKIYGRVIIVRDRNRFHHFREGSCSCGD 826 Query: 69 YW 64 YW Sbjct: 827 YW 828 >ref|XP_008235102.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890 [Prunus mume] Length = 571 Score = 95.1 bits (235), Expect = 2e-17 Identities = 41/62 (66%), Positives = 46/62 (74%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AF LKTS PIRI KNLRIC DCHDAMK IS+ + R +++RDC RFH FR G CSC D Sbjct: 510 AFCFLKTSPGTPIRIVKNLRICRDCHDAMKMISKEFDREIVIRDCNRFHHFRQGLCSCKD 569 Query: 69 YW 64 YW Sbjct: 570 YW 571 >ref|XP_007201172.1| hypothetical protein PRUPE_ppa003481mg [Prunus persica] gi|462396572|gb|EMJ02371.1| hypothetical protein PRUPE_ppa003481mg [Prunus persica] Length = 571 Score = 95.1 bits (235), Expect = 2e-17 Identities = 41/62 (66%), Positives = 46/62 (74%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AF LKTS PIRI KNLRIC DCHDAMK IS+ + R +++RDC RFH FR G CSC D Sbjct: 510 AFCFLKTSPGTPIRIVKNLRICRDCHDAMKMISKEFDREIVIRDCNRFHHFRQGLCSCKD 569 Query: 69 YW 64 YW Sbjct: 570 YW 571 >ref|XP_010660114.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Vitis vinifera] Length = 801 Score = 94.0 bits (232), Expect = 4e-17 Identities = 41/62 (66%), Positives = 47/62 (75%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AFGL+ T+ S PIRI KNLR+C DCH A K +S+ YGRV+IVRD RFH FR G CSC D Sbjct: 740 AFGLISTAPSTPIRIVKNLRVCNDCHAATKLLSKIYGRVIIVRDRNRFHHFREGYCSCGD 799 Query: 69 YW 64 YW Sbjct: 800 YW 801 >ref|XP_006476888.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Citrus sinensis] Length = 695 Score = 94.0 bits (232), Expect = 4e-17 Identities = 39/62 (62%), Positives = 49/62 (79%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AFGL++TS PIRI+KNLR+C DCH+A K IS+ + R ++VRD TRFH F+ G CSCND Sbjct: 634 AFGLIRTSPGTPIRISKNLRVCTDCHNATKIISKVFNREIVVRDWTRFHHFKEGSCSCND 693 Query: 69 YW 64 YW Sbjct: 694 YW 695 >emb|CAN80796.1| hypothetical protein VITISV_034275 [Vitis vinifera] Length = 771 Score = 94.0 bits (232), Expect = 4e-17 Identities = 41/62 (66%), Positives = 47/62 (75%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AFGL+ T+ S PIRI KNLR+C DCH A K +S+ YGRV+IVRD RFH FR G CSC D Sbjct: 710 AFGLISTAPSTPIRIVKNLRVCNDCHAATKLLSKIYGRVIIVRDRNRFHHFREGYCSCGD 769 Query: 69 YW 64 YW Sbjct: 770 YW 771 >ref|XP_011624250.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Amborella trichopoda] Length = 606 Score = 93.2 bits (230), Expect = 6e-17 Identities = 41/62 (66%), Positives = 47/62 (75%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AFGLL TS+ IRIAKNLRIC DCH MK +S+ +GR ++VRDC RFH FR G CSC D Sbjct: 545 AFGLLSTSSHGVIRIAKNLRICRDCHHFMKLVSKVFGRDIVVRDCNRFHQFREGLCSCKD 604 Query: 69 YW 64 YW Sbjct: 605 YW 606 >ref|XP_009373739.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like [Pyrus x bretschneideri] Length = 845 Score = 93.2 bits (230), Expect = 6e-17 Identities = 40/62 (64%), Positives = 49/62 (79%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AFGL+ TS S PIR+ KNLR+C DCH A+K ISEA GR ++VRD RFH F+ G+CSCN+ Sbjct: 784 AFGLISTSKSKPIRVFKNLRVCGDCHTAIKYISEATGREIVVRDSNRFHHFKDGRCSCNE 843 Query: 69 YW 64 YW Sbjct: 844 YW 845 >ref|XP_008341824.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic [Malus domestica] Length = 845 Score = 93.2 bits (230), Expect = 6e-17 Identities = 40/62 (64%), Positives = 49/62 (79%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AFGL+ TS S PIR+ KNLR+C DCH A+K ISEA GR ++VRD RFH F+ G+CSCN+ Sbjct: 784 AFGLISTSKSKPIRVFKNLRVCGDCHTAIKYISEATGREIVVRDSNRFHHFKDGRCSCNE 843 Query: 69 YW 64 YW Sbjct: 844 YW 845 >gb|EEC84744.1| hypothetical protein OsI_31741 [Oryza sativa Indica Group] Length = 563 Score = 93.2 bits (230), Expect = 6e-17 Identities = 39/62 (62%), Positives = 48/62 (77%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AFGL+ T+ PIRIAKNLR+C DCH+A+K +S+ YGR +IVRD RFH FR G CSC D Sbjct: 502 AFGLISTAPGTPIRIAKNLRVCGDCHNAVKLLSKIYGRCIIVRDANRFHHFREGSCSCGD 561 Query: 69 YW 64 +W Sbjct: 562 FW 563 >ref|XP_010685827.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Beta vulgaris subsp. vulgaris] gi|870853429|gb|KMT05310.1| hypothetical protein BVRB_7g174460 [Beta vulgaris subsp. vulgaris] Length = 624 Score = 92.8 bits (229), Expect = 8e-17 Identities = 41/62 (66%), Positives = 48/62 (77%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AFGLLKT A IRI+KNLR+C DCH A K IS+A+ R +IVRD RFH FR G+CSCND Sbjct: 563 AFGLLKTKAGQTIRISKNLRVCRDCHQASKLISKAFDREIIVRDRNRFHHFRNGECSCND 622 Query: 69 YW 64 +W Sbjct: 623 FW 624 >ref|XP_010276442.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Nelumbo nucifera] Length = 523 Score = 92.8 bits (229), Expect = 8e-17 Identities = 42/62 (67%), Positives = 46/62 (74%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AFGLL T AS PIRI KNLR+C DCH MKSIS+ Y R ++VRD TRFH F G CSC D Sbjct: 462 AFGLLNTCASTPIRIVKNLRMCADCHRLMKSISKVYKREIVVRDSTRFHRFMEGGCSCKD 521 Query: 69 YW 64 YW Sbjct: 522 YW 523 >ref|XP_008388704.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Malus domestica] Length = 803 Score = 92.8 bits (229), Expect = 8e-17 Identities = 39/62 (62%), Positives = 47/62 (75%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AFGL+ +A PIR+ KNLR+C+DCH A K +S+ YGRV+IVRD RFH FR G CSC D Sbjct: 742 AFGLIAXAAGTPIRVVKNLRVCDDCHTATKLLSKIYGRVIIVRDRNRFHHFREGSCSCGD 801 Query: 69 YW 64 YW Sbjct: 802 YW 803 >ref|XP_010241372.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Nelumbo nucifera] Length = 692 Score = 92.4 bits (228), Expect = 1e-16 Identities = 39/62 (62%), Positives = 46/62 (74%) Frame = -1 Query: 249 AFGLLKTSASMPIRIAKNLRICEDCHDAMKSISEAYGRVVIVRDCTRFH*FRAGQCSCND 70 AFGLL T PIRI KNLRIC+DCH MK +S+ Y R++I+RDC RFH F G CSC+D Sbjct: 631 AFGLLSTDPGTPIRIVKNLRICDDCHAFMKMVSKYYNRLMIIRDCNRFHHFADGSCSCSD 690 Query: 69 YW 64 YW Sbjct: 691 YW 692