BLASTX nr result
ID: Cinnamomum23_contig00030112
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00030112 (274 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009804318.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 ref|XP_009596666.1| PREDICTED: putative pentatricopeptide repeat... 62 1e-07 ref|XP_006358601.1| PREDICTED: pentatricopeptide repeat-containi... 60 7e-07 ref|XP_004246180.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 >ref|XP_009804318.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Nicotiana sylvestris] Length = 639 Score = 63.2 bits (152), Expect = 7e-08 Identities = 33/69 (47%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = -1 Query: 217 MAVISKVSKSKLRPCSLYLDRILKTQQNLSKSSPKIWK-QHKSDKFDDPNTRGERLLTLS 41 MAV K K L S Y+++ +KTQ NLSK PK+W QH ++ FD N ++L LS Sbjct: 1 MAVRFKHPKQSLSLSSEYVNKFIKTQINLSKPPPKLWSDQHDAESFDPYNNNSAQILNLS 60 Query: 40 HPLLRILES 14 HP+LRIL+S Sbjct: 61 HPILRILDS 69 >ref|XP_009596666.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g37570 [Nicotiana tomentosiformis] Length = 639 Score = 62.4 bits (150), Expect = 1e-07 Identities = 32/68 (47%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = -1 Query: 217 MAVISKVSKSKLRPCSLYLDRILKTQQNLSKSSPKIWK-QHKSDKFDDPNTRGERLLTLS 41 MAV K K L S Y+++ +KTQ NLSK +PK+W QH ++ FD N ++L LS Sbjct: 1 MAVRFKHPKQSLSLSSEYVNKFIKTQINLSKPTPKLWSDQHNAESFDPYNNNSVQILNLS 60 Query: 40 HPLLRILE 17 HP+LRIL+ Sbjct: 61 HPILRILD 68 >ref|XP_006358601.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Solanum tuberosum] Length = 639 Score = 59.7 bits (143), Expect = 7e-07 Identities = 33/69 (47%), Positives = 42/69 (60%), Gaps = 1/69 (1%) Frame = -1 Query: 217 MAVISKVSKSKLRPCSLYLDRILKTQQNLSKSSPKIWKQHKSDKFDDPNTRG-ERLLTLS 41 MAV K SK L Y+++ +KTQ NLSK +PK+W H + DP G LTLS Sbjct: 1 MAVRFKHSKQSLSLSLEYVNKFIKTQINLSKPTPKLWSDHDDAQSFDPYNNGVHSTLTLS 60 Query: 40 HPLLRILES 14 HP+LRIL+S Sbjct: 61 HPILRILDS 69 >ref|XP_004246180.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Solanum lycopersicum] Length = 639 Score = 57.8 bits (138), Expect = 3e-06 Identities = 32/69 (46%), Positives = 42/69 (60%), Gaps = 1/69 (1%) Frame = -1 Query: 217 MAVISKVSKSKLRPCSLYLDRILKTQQNLSKSSPKIWKQHKSDKFDDPNTRG-ERLLTLS 41 MAV K K + S Y+++ +KTQ NLSK +PK+W H + DP G LTLS Sbjct: 1 MAVRFKHMKQYVSLSSEYVNKFIKTQINLSKPTPKLWSDHDDVQSFDPYNNGVHSTLTLS 60 Query: 40 HPLLRILES 14 HP+LRIL+S Sbjct: 61 HPILRILDS 69