BLASTX nr result
ID: Cinnamomum23_contig00029967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00029967 (253 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007516896.1| hypothetical protein GlmaxMp48 (mitochondrio... 58 2e-06 >ref|YP_007516896.1| hypothetical protein GlmaxMp48 (mitochondrion) [Glycine max] gi|403311610|gb|AFR34358.1| hypothetical protein GlmaxMp48 (mitochondrion) [Glycine max] Length = 261 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 1 GSSRGSGWTSFDIGVIAEPFQNEEGEEVAQ 90 GSSRGSGWTSFDI V+ EPF NEEGEEVAQ Sbjct: 107 GSSRGSGWTSFDINVLGEPFPNEEGEEVAQ 136