BLASTX nr result
ID: Cinnamomum23_contig00029924
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00029924 (244 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001262898.1| hypothetical protein NFIA_115880 [Neosartory... 69 1e-10 ref|XP_007297914.1| hypothetical protein MBM_10038 [Marssonina b... 60 7e-07 >ref|XP_001262898.1| hypothetical protein NFIA_115880 [Neosartorya fischeri NRRL 181] gi|119411057|gb|EAW21001.1| hypothetical protein NFIA_115880, partial [Neosartorya fischeri NRRL 181] Length = 88 Score = 68.9 bits (167), Expect(2) = 1e-10 Identities = 39/60 (65%), Positives = 44/60 (73%), Gaps = 2/60 (3%) Frame = -3 Query: 236 HYASVLAKARSSIRAGRIAPWAITLPGGSHIP*AFVRPPKSTLACPQKNTP--KPAEQLR 63 HYASV A+ARSS++AGRIA AI PGG +IP AF RPPK TLA PQ +TP PAE R Sbjct: 16 HYASVRAEARSSVQAGRIALPAIRCPGGHYIPGAFDRPPKPTLARPQGSTPARMPAEPWR 75 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -1 Query: 61 QVWWQELPFQQF 26 +VW Q LPFQQF Sbjct: 76 RVWSQALPFQQF 87 >ref|XP_007297914.1| hypothetical protein MBM_10038 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406858711|gb|EKD11810.1| hypothetical protein MBM_10038 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 288 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -3 Query: 239 SHYASVLAKARSSIRAGRIAPWAITLPGGSHIP*AFVRPPKSTLA 105 +HYAS+LA+ARSS+ G +AP AITLP GS++P AF+ PPK LA Sbjct: 244 NHYASILAEARSSVPVGGMAPRAITLPEGSYVPRAFIPPPKPMLA 288