BLASTX nr result
ID: Cinnamomum23_contig00029770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00029770 (218 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010276946.1| PREDICTED: pentatricopeptide repeat-containi... 84 5e-14 ref|XP_010647558.1| PREDICTED: pentatricopeptide repeat-containi... 83 8e-14 ref|XP_010647598.1| PREDICTED: pentatricopeptide repeat-containi... 83 8e-14 ref|XP_010662840.1| PREDICTED: pentatricopeptide repeat-containi... 83 8e-14 emb|CBI41122.3| unnamed protein product [Vitis vinifera] 83 8e-14 emb|CBI23560.3| unnamed protein product [Vitis vinifera] 83 8e-14 emb|CBI23556.3| unnamed protein product [Vitis vinifera] 83 8e-14 ref|XP_003635637.1| PREDICTED: pentatricopeptide repeat-containi... 83 8e-14 gb|KDO46745.1| hypothetical protein CISIN_1g002975mg [Citrus sin... 82 1e-13 ref|XP_006422178.1| hypothetical protein CICLE_v10006927mg [Citr... 82 1e-13 ref|XP_004151259.1| PREDICTED: pentatricopeptide repeat-containi... 80 7e-13 ref|XP_010915655.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_010044231.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-12 ref|XP_008783966.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-12 gb|KCW88451.1| hypothetical protein EUGRSUZ_A00839 [Eucalyptus g... 79 2e-12 ref|XP_008441615.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-12 ref|XP_009760814.1| PREDICTED: pentatricopeptide repeat-containi... 76 8e-12 ref|XP_009760813.1| PREDICTED: pentatricopeptide repeat-containi... 76 8e-12 ref|XP_009404489.1| PREDICTED: pentatricopeptide repeat-containi... 76 8e-12 ref|XP_012440013.1| PREDICTED: pentatricopeptide repeat-containi... 76 1e-11 >ref|XP_010276946.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic [Nelumbo nucifera] Length = 856 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/57 (64%), Positives = 50/57 (87%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 SG+ME+A+KAF+ILFEKN++SY+ ++DG+AKN SEEAFEL+H E++GIGV FTF Sbjct: 431 SGKMEDARKAFDILFEKNMVSYNTLIDGYAKNLSSEEAFELFHLSENVGIGVNAFTF 487 >ref|XP_010647558.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like, partial [Vitis vinifera] Length = 556 Score = 82.8 bits (203), Expect = 8e-14 Identities = 38/57 (66%), Positives = 49/57 (85%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 SGRME+A+KAF+ILFEKNL+SY+ +VDG+AKN SEEAF L+++I D GIG+ FTF Sbjct: 131 SGRMEDARKAFDILFEKNLVSYNAIVDGYAKNLKSEEAFLLFNEIADTGIGISAFTF 187 >ref|XP_010647598.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like [Vitis vinifera] Length = 782 Score = 82.8 bits (203), Expect = 8e-14 Identities = 38/57 (66%), Positives = 49/57 (85%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 SGRME+A+KAF+ILFEKNL+SY+ +VDG+AKN SEEAF L+++I D GIG+ FTF Sbjct: 357 SGRMEDARKAFDILFEKNLVSYNAIVDGYAKNLKSEEAFLLFNEIADTGIGISAFTF 413 >ref|XP_010662840.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like [Vitis vinifera] Length = 620 Score = 82.8 bits (203), Expect = 8e-14 Identities = 38/57 (66%), Positives = 49/57 (85%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 SGRME+A+KAF+ILFEKNL+SY+ +VDG+AKN SEEAF L+++I D GIG+ FTF Sbjct: 422 SGRMEDARKAFDILFEKNLVSYNAIVDGYAKNLKSEEAFLLFNEIADTGIGISAFTF 478 >emb|CBI41122.3| unnamed protein product [Vitis vinifera] Length = 634 Score = 82.8 bits (203), Expect = 8e-14 Identities = 38/57 (66%), Positives = 49/57 (85%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 SGRME+A+KAF+ILFEKNL+SY+ +VDG+AKN SEEAF L+++I D GIG+ FTF Sbjct: 209 SGRMEDARKAFDILFEKNLVSYNAIVDGYAKNLKSEEAFLLFNEIADTGIGISAFTF 265 >emb|CBI23560.3| unnamed protein product [Vitis vinifera] Length = 497 Score = 82.8 bits (203), Expect = 8e-14 Identities = 38/57 (66%), Positives = 49/57 (85%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 SGRME+A+KAF+ILFEKNL+SY+ +VDG+AKN SEEAF L+++I D GIG+ FTF Sbjct: 72 SGRMEDARKAFDILFEKNLVSYNAIVDGYAKNLKSEEAFLLFNEIADTGIGISAFTF 128 >emb|CBI23556.3| unnamed protein product [Vitis vinifera] Length = 827 Score = 82.8 bits (203), Expect = 8e-14 Identities = 38/57 (66%), Positives = 49/57 (85%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 SGRME+A+KAF+ILFEKNL+SY+ +VDG+AKN SEEAF L+++I D GIG+ FTF Sbjct: 402 SGRMEDARKAFDILFEKNLVSYNAIVDGYAKNLKSEEAFLLFNEIADTGIGISAFTF 458 >ref|XP_003635637.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like, partial [Vitis vinifera] Length = 629 Score = 82.8 bits (203), Expect = 8e-14 Identities = 38/57 (66%), Positives = 49/57 (85%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 SGRME+A+KAF+ILFEKNL+SY+ +VDG+AKN SEEAF L+++I D GIG+ FTF Sbjct: 204 SGRMEDARKAFDILFEKNLVSYNAIVDGYAKNLKSEEAFLLFNEIADTGIGISAFTF 260 >gb|KDO46745.1| hypothetical protein CISIN_1g002975mg [Citrus sinensis] Length = 861 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/57 (64%), Positives = 47/57 (82%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 SGRME+A+KAF LFEKNL+SY+ MVD +AKN +SE+AFEL H+IED G+G +TF Sbjct: 436 SGRMEDARKAFESLFEKNLVSYNTMVDAYAKNLNSEKAFELLHEIEDTGVGTSAYTF 492 >ref|XP_006422178.1| hypothetical protein CICLE_v10006927mg [Citrus clementina] gi|568874825|ref|XP_006490514.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like [Citrus sinensis] gi|557524051|gb|ESR35418.1| hypothetical protein CICLE_v10006927mg [Citrus clementina] Length = 861 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/57 (64%), Positives = 47/57 (82%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 SGRME+A+KAF LFEKNL+SY+ MVD +AKN +SE+AFEL H+IED G+G +TF Sbjct: 436 SGRMEDARKAFESLFEKNLVSYNTMVDAYAKNLNSEKAFELLHEIEDTGVGTSAYTF 492 >ref|XP_004151259.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic [Cucumis sativus] gi|700203141|gb|KGN58274.1| hypothetical protein Csa_3G603610 [Cucumis sativus] Length = 849 Score = 79.7 bits (195), Expect = 7e-13 Identities = 35/57 (61%), Positives = 49/57 (85%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 SGR+++A+KAF+ILFEKNLISY+ ++D +AKN +SEEA EL+++IED G+G FTF Sbjct: 424 SGRIDDARKAFDILFEKNLISYNTVIDAYAKNLNSEEALELFNEIEDQGMGASAFTF 480 >ref|XP_010915655.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic [Elaeis guineensis] Length = 862 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/57 (63%), Positives = 47/57 (82%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 SGRME+A KAF++L+EKN+ISY+ +VDG+ KN+++EEA EL HQ E M IGV FTF Sbjct: 437 SGRMEDAIKAFDVLYEKNIISYNAIVDGYLKNSNAEEALELLHQTESMDIGVSAFTF 493 >ref|XP_010044231.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic [Eucalyptus grandis] Length = 845 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/57 (61%), Positives = 46/57 (80%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 SG ME+AQ+AF+ LFEKNL+SY+ +VD +AK+ S+EAFEL H+IE+ GIG FTF Sbjct: 420 SGHMEDAQRAFDALFEKNLVSYNTLVDAYAKSLESDEAFELLHEIEERGIGTSAFTF 476 >ref|XP_008783966.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic [Phoenix dactylifera] Length = 862 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/57 (61%), Positives = 47/57 (82%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 SGRME+A KAF++L+EKN+ISY+ ++DG+ KN+++EEA EL HQ E M IGV FTF Sbjct: 437 SGRMEDAIKAFDVLYEKNIISYNAVIDGYLKNSNAEEALELLHQTESMDIGVSAFTF 493 >gb|KCW88451.1| hypothetical protein EUGRSUZ_A00839 [Eucalyptus grandis] Length = 841 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/57 (61%), Positives = 46/57 (80%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 SG ME+AQ+AF+ LFEKNL+SY+ +VD +AK+ S+EAFEL H+IE+ GIG FTF Sbjct: 416 SGHMEDAQRAFDALFEKNLVSYNTLVDAYAKSLESDEAFELLHEIEERGIGTSAFTF 472 >ref|XP_008441615.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic [Cucumis melo] Length = 849 Score = 77.0 bits (188), Expect = 4e-12 Identities = 34/57 (59%), Positives = 48/57 (84%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 SGR+++A+KAF+ILFEKNLISY+ ++D +A N +SEEAF L+++IED G+G FTF Sbjct: 424 SGRIDDARKAFDILFEKNLISYNTVIDAYATNLNSEEAFVLFNEIEDQGMGASAFTF 480 >ref|XP_009760814.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic isoform X2 [Nicotiana sylvestris] gi|698527937|ref|XP_009760815.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic isoform X3 [Nicotiana sylvestris] Length = 849 Score = 76.3 bits (186), Expect = 8e-12 Identities = 37/57 (64%), Positives = 47/57 (82%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 SGRMEEA+KAF +LFEKNL+SY+I+VDG++KN S EAFEL+ QI D +G+ FTF Sbjct: 425 SGRMEEARKAFELLFEKNLVSYNIIVDGYSKNLDSTEAFELFSQI-DSEVGIDAFTF 480 >ref|XP_009760813.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic isoform X1 [Nicotiana sylvestris] Length = 849 Score = 76.3 bits (186), Expect = 8e-12 Identities = 37/57 (64%), Positives = 47/57 (82%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 SGRMEEA+KAF +LFEKNL+SY+I+VDG++KN S EAFEL+ QI D +G+ FTF Sbjct: 425 SGRMEEARKAFELLFEKNLVSYNIIVDGYSKNLDSTEAFELFSQI-DSEVGIDAFTF 480 >ref|XP_009404489.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic [Musa acuminata subsp. malaccensis] Length = 862 Score = 76.3 bits (186), Expect = 8e-12 Identities = 33/57 (57%), Positives = 47/57 (82%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 +GRMEEA++AF++L+EKN++SY+ +VDG+AKN+ EEA EL +QIE M +G FTF Sbjct: 437 AGRMEEARRAFSLLYEKNVVSYNAIVDGYAKNSDCEEALELLYQIESMDVGASAFTF 493 >ref|XP_012440013.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic [Gossypium raimondii] gi|763785523|gb|KJB52594.1| hypothetical protein B456_008G269700 [Gossypium raimondii] Length = 859 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/57 (63%), Positives = 44/57 (77%) Frame = -1 Query: 218 SGRMEEAQKAFNILFEKNLISYSIMVDGFAKNTHSEEAFELYHQIEDMGIGVCGFTF 48 SGRM++AQKAF LFEKNL SY+ +VD +AKN SE AFEL+H+I D G+ V FTF Sbjct: 434 SGRMDDAQKAFESLFEKNLDSYNTVVDAYAKNLDSEGAFELFHEISDFGVEVNAFTF 490