BLASTX nr result
ID: Cinnamomum23_contig00029635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00029635 (347 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010648136.1| PREDICTED: uncharacterized protein LOC104878... 40 4e-06 >ref|XP_010648136.1| PREDICTED: uncharacterized protein LOC104878909 [Vitis vinifera] Length = 352 Score = 40.4 bits (93), Expect(3) = 4e-06 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = +3 Query: 54 IPVT*KCLVSFRIGGYKDKIWCDVISMNVTH 146 IPV CLVS G Y D IWCDVI M H Sbjct: 278 IPVNQCCLVSLSCGVYNDSIWCDVIPMKAAH 308 Score = 34.3 bits (77), Expect(3) = 4e-06 Identities = 15/33 (45%), Positives = 23/33 (69%) Frame = +1 Query: 154 G*P*LFDRTVHNDKEKNTYSFLWKGKWVTFVPL 252 G P L+DR VH+ ++NTYSF++K + V P+ Sbjct: 312 GRPWLYDRDVHHCGKENTYSFMFKNQKVVLKPM 344 Score = 21.6 bits (44), Expect(3) = 4e-06 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 Query: 5 VEKLSKPYKVTWAN 46 VE +PYKV W N Sbjct: 261 VEPHPQPYKVAWIN 274