BLASTX nr result
ID: Cinnamomum23_contig00029617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00029617 (248 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011074733.1| PREDICTED: ATP-dependent zinc metalloproteas... 65 1e-08 ref|XP_011101039.1| PREDICTED: ATP-dependent zinc metalloproteas... 60 6e-07 ref|XP_012839216.1| PREDICTED: ATP-dependent zinc metalloproteas... 58 2e-06 gb|EYU36826.1| hypothetical protein MIMGU_mgv1a002176mg [Erythra... 58 2e-06 >ref|XP_011074733.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like [Sesamum indicum] Length = 703 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -1 Query: 170 MALSSTNPLLSSNFFGTKIFISPPTPKTVPRKFLVQDSI 54 MA + TNPLLSSNFFGT+IFISPPTPKTVPR FLV +I Sbjct: 1 MASTLTNPLLSSNFFGTQIFISPPTPKTVPRSFLVPQAI 39 >ref|XP_011101039.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic [Sesamum indicum] Length = 703 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 170 MALSSTNPLLSSNFFGTKIFISPPTPKTVPRKFLVQDSI 54 MA + TNPLLSSNFFGT+++IS PTPKTV RKF+V SI Sbjct: 1 MASALTNPLLSSNFFGTQVYISSPTPKTVSRKFIVPQSI 39 >ref|XP_012839216.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic [Erythranthe guttatus] gi|604331969|gb|EYU36827.1| hypothetical protein MIMGU_mgv1a002176mg [Erythranthe guttata] Length = 705 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 170 MALSSTNPLLSSNFFGTKIFISPPTPKTVPRKF 72 MA + TNPLLSS FFGT+IFISPPTPKTVP++F Sbjct: 1 MASTLTNPLLSSKFFGTQIFISPPTPKTVPKRF 33 >gb|EYU36826.1| hypothetical protein MIMGU_mgv1a002176mg [Erythranthe guttata] Length = 656 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 170 MALSSTNPLLSSNFFGTKIFISPPTPKTVPRKF 72 MA + TNPLLSS FFGT+IFISPPTPKTVP++F Sbjct: 1 MASTLTNPLLSSKFFGTQIFISPPTPKTVPKRF 33