BLASTX nr result
ID: Cinnamomum23_contig00029475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00029475 (487 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006352475.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_004250548.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-10 ref|XP_007152938.1| hypothetical protein PHAVU_004G172900g [Phas... 69 2e-09 emb|CDO99958.1| unnamed protein product [Coffea canephora] 67 6e-09 ref|XP_003530188.2| PREDICTED: pentatricopeptide repeat-containi... 67 6e-09 ref|XP_008368714.1| PREDICTED: pentatricopeptide repeat-containi... 66 8e-09 ref|XP_008244392.1| PREDICTED: pentatricopeptide repeat-containi... 66 8e-09 ref|XP_006372504.1| hypothetical protein POPTR_0017s02260g [Popu... 63 7e-08 emb|CDY02282.1| BnaA03g38850D [Brassica napus] 60 6e-07 ref|XP_001351287.1| conserved Plasmodium protein, unknown functi... 60 7e-07 ref|NP_200198.1| early nodulin-like protein 1 [Arabidopsis thali... 59 1e-06 ref|XP_011038297.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_009136277.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 gb|KFK25509.1| hypothetical protein AALP_AA8G124100 [Arabis alpina] 59 1e-06 gb|AAZ54315.1| Surface protein from Gram-positive cocci, anchor ... 59 1e-06 dbj|BAD43029.1| predicted GPI-anchored protein [Arabidopsis thal... 59 1e-06 ref|XP_009764432.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_011082278.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_004288384.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_011407990.1| PREDICTED: DNA-directed RNA polymerase II su... 58 2e-06 >ref|XP_006352475.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330-like [Solanum tuberosum] Length = 646 Score = 72.0 bits (175), Expect = 1e-10 Identities = 34/84 (40%), Positives = 57/84 (67%), Gaps = 3/84 (3%) Frame = -3 Query: 263 SHSTSKKPNHNPLHSTCTQVEYLCKSSKLQEALQLLETKSPDEIEVQTYSLLLHTCISKR 84 ++S+ KK N P + + ++ L KS KL EAL L+E++ ++++++YS LLH CISK+ Sbjct: 20 ANSSFKKLNKTPTNPFNSSLKSLTKSGKLDEALLLIESQKSSQLDIESYSSLLHACISKK 79 Query: 83 SIQHGERIHRHLL---RSNLLKDP 21 S++HG R++ HLL ++L DP Sbjct: 80 SVEHGHRLYIHLLLNSNKSILNDP 103 >ref|XP_004250548.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330 [Solanum lycopersicum] gi|723742047|ref|XP_010312728.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330 [Solanum lycopersicum] Length = 646 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/84 (40%), Positives = 56/84 (66%), Gaps = 3/84 (3%) Frame = -3 Query: 263 SHSTSKKPNHNPLHSTCTQVEYLCKSSKLQEALQLLETKSPDEIEVQTYSLLLHTCISKR 84 ++S+ KK N P + + ++ L KS KL EAL L+E++ ++++++YS LLH CISK+ Sbjct: 20 ANSSFKKLNKTPTNPFNSSLKSLTKSGKLDEALLLIESQKSSQLDIESYSSLLHACISKK 79 Query: 83 SIQHGERIHRHLL---RSNLLKDP 21 S++HG R++ HLL + L DP Sbjct: 80 SVEHGHRLYIHLLLNSNKSFLNDP 103 >ref|XP_007152938.1| hypothetical protein PHAVU_004G172900g [Phaseolus vulgaris] gi|561026247|gb|ESW24932.1| hypothetical protein PHAVU_004G172900g [Phaseolus vulgaris] Length = 648 Score = 68.6 bits (166), Expect = 2e-09 Identities = 39/102 (38%), Positives = 59/102 (57%), Gaps = 6/102 (5%) Frame = -3 Query: 290 TSNKPNHNPSHSTSKKPNHNPLHSTCTQVEYLCKSSKLQEALQLLETKSPDEIEVQT--- 120 T P + + K P +ST ++ LCK L EAL+L+E+ P IE + Sbjct: 15 TKTAATSTPRTTNTHKHRTTPFNST---LKSLCKWGNLDEALRLIESSKPTVIEKEEEEE 71 Query: 119 -YSLLLHTCISKRSIQHGERIHRHLLRS--NLLKDPNLQRQI 3 SL LHTCIS+RS++HG ++H HLLRS +L++P L+ ++ Sbjct: 72 GVSLFLHTCISRRSLEHGRKLHLHLLRSQNRVLENPTLKSKL 113 >emb|CDO99958.1| unnamed protein product [Coffea canephora] Length = 641 Score = 66.6 bits (161), Expect = 6e-09 Identities = 35/76 (46%), Positives = 51/76 (67%) Frame = -3 Query: 248 KKPNHNPLHSTCTQVEYLCKSSKLQEALQLLETKSPDEIEVQTYSLLLHTCISKRSIQHG 69 ++ NH PL+ST + L KS KL EALQL+E + +EV++ + LH CIS +S+QHG Sbjct: 27 QRKNHKPLNST---FKSLSKSGKLDEALQLIEFQQFRNLEVESCTTFLHACISTKSLQHG 83 Query: 68 ERIHRHLLRSNLLKDP 21 +R+++H L S LL P Sbjct: 84 QRLYKH-LPSTLLSSP 98 >ref|XP_003530188.2| PREDICTED: pentatricopeptide repeat-containing protein At3g14330-like [Glycine max] Length = 706 Score = 66.6 bits (161), Expect = 6e-09 Identities = 38/107 (35%), Positives = 63/107 (58%), Gaps = 6/107 (5%) Frame = -3 Query: 305 NPSHSTSNKPNHNPSHSTSKKPNHNPLHSTCTQVEYLCKSSKLQEALQLLETKSP----D 138 N + T+ P + + K P +ST ++ LCK L +AL+L+E+ P + Sbjct: 66 NITVKTNITATSTPRTTNTHKHKTTPFNST---LKSLCKWGNLDKALRLIESSKPTPIEE 122 Query: 137 EIEVQTYSLLLHTCISKRSIQHGERIHRHLLRS--NLLKDPNLQRQI 3 E E ++ SL LH CIS+RS++HG ++H HLLRS +L++P L+ ++ Sbjct: 123 EEEEESISLFLHACISRRSLEHGRKLHLHLLRSQNRVLENPTLKTKL 169 >ref|XP_008368714.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330-like [Malus domestica] Length = 654 Score = 66.2 bits (160), Expect = 8e-09 Identities = 40/94 (42%), Positives = 65/94 (69%), Gaps = 12/94 (12%) Frame = -3 Query: 248 KKPNHNPLHSTCTQVEYLCKSSKLQEALQLLETKSPDEI-----EVQTYSLLLHTCISKR 84 +KP+ PL ST +++L KS KL EAL+L+E+ SP ++ +++ YSLLLHTCIS+R Sbjct: 29 QKPS-KPLPST---LKWLAKSGKLDEALRLIES-SPSKLTATQSDIEAYSLLLHTCISRR 83 Query: 83 SIQHGERIHRHLLRSN-------LLKDPNLQRQI 3 S++HG+R++ LL S+ LL++P L+ ++ Sbjct: 84 SLEHGQRLYLQLLLSDDRXENGILLRNPTLKSKL 117 >ref|XP_008244392.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330 [Prunus mume] Length = 636 Score = 66.2 bits (160), Expect = 8e-09 Identities = 43/109 (39%), Positives = 66/109 (60%), Gaps = 12/109 (11%) Frame = -3 Query: 293 STSNKPNHNPSHSTSKKPNHNPLHSTCTQVEYLCKSSKLQEALQLLETKSPD-----EIE 129 + ++ PN HS PL ST +++L KS KL EAL+L+E+ SP E++ Sbjct: 2 TVTSGPNGTKKHS-------KPLTST---LKWLAKSGKLDEALRLIES-SPSRLTFTELD 50 Query: 128 VQTYSLLLHTCISKRSIQHGERIHRHLLRS-------NLLKDPNLQRQI 3 V+ YSLLLHTCIS++S++HG R++ LL S +LL +P L+ ++ Sbjct: 51 VEAYSLLLHTCISRKSLEHGRRLYLQLLLSKDRGNNHSLLHNPTLKSKL 99 >ref|XP_006372504.1| hypothetical protein POPTR_0017s02260g [Populus trichocarpa] gi|550319130|gb|ERP50301.1| hypothetical protein POPTR_0017s02260g [Populus trichocarpa] Length = 648 Score = 63.2 bits (152), Expect = 7e-08 Identities = 32/88 (36%), Positives = 57/88 (64%), Gaps = 4/88 (4%) Frame = -3 Query: 254 TSKKPNHNPLHSTCTQVEYLCKSSKLQEALQLLETKSPDEIEVQTYSLLLHTCISKRSIQ 75 + K P+ NP + T ++YL KS L EA++L+E+ + +TYS LLH+CIS++S+ Sbjct: 25 SQKPPSKNPQNLNQT-LKYLTKSGNLDEAIRLIESSPSKFTDPETYSQLLHSCISQKSLH 83 Query: 74 HGERIHRHLLR----SNLLKDPNLQRQI 3 HG+R+++ LL+ L++ NL+ ++ Sbjct: 84 HGQRVYKQLLKQEYSEKFLENHNLKGKL 111 >emb|CDY02282.1| BnaA03g38850D [Brassica napus] Length = 503 Score = 60.1 bits (144), Expect = 6e-07 Identities = 40/143 (27%), Positives = 68/143 (47%), Gaps = 10/143 (6%) Frame = -3 Query: 401 SNKPKHNPSHSNNLNNKPTQNQS----HFTSNKRNHNPSHSTSNKPNHNPS----HSTSK 246 S P S ++ QNQS H + N +P H +P H P + + Sbjct: 63 SYPPPQRQSPPPGFDSHRFQNQSNTDHHRAPQRYNQSPQHG-GYRPQHAPRGGYHNQNVQ 121 Query: 245 KPNH-NPLHSTCTQVEYLCKSSKLQEALQLLETKS-PDEIEVQTYSLLLHTCISKRSIQH 72 PN N + T ++ LCK + ++A++LL+ + PD+ +SLL +C + +S++H Sbjct: 122 NPNQSNEIAPTVEEIVRLCKLRRFKDAIELLDKGALPDK---DCFSLLFESCANLKSLEH 178 Query: 71 GERIHRHLLRSNLLKDPNLQRQI 3 +++H H LRS DP L + Sbjct: 179 SKKVHDHFLRSVFRSDPKLNNVV 201 >ref|XP_001351287.1| conserved Plasmodium protein, unknown function [Plasmodium falciparum 3D7] gi|8052285|emb|CAB39037.2| conserved Plasmodium protein, unknown function [Plasmodium falciparum 3D7] Length = 1946 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/71 (38%), Positives = 42/71 (59%) Frame = -3 Query: 416 SSHSTSNKPKHNPSHSNNLNNKPTQNQSHFTSNKRNHNPSHSTSNKPNHNPSHSTSKKPN 237 +SH+ S+ HN SH+N+ NN + N SH S+ +HN SH+ S+ +HN SH+ S + Sbjct: 312 NSHNNSHNNSHNNSHNNSHNN--SHNNSHNNSHNNSHNNSHNNSHNNSHNNSHNNSHNNS 369 Query: 236 HNPLHSTCTQV 204 HN H+ + Sbjct: 370 HNNSHNNSCNI 380 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/66 (40%), Positives = 41/66 (62%) Frame = -3 Query: 416 SSHSTSNKPKHNPSHSNNLNNKPTQNQSHFTSNKRNHNPSHSTSNKPNHNPSHSTSKKPN 237 +SH+ S+ HN SH+N+ NN + N SH S+ +HN SH+ S+ +HN SH+ S + Sbjct: 308 NSHNNSHNNSHNNSHNNSHNN--SHNNSHNNSHNNSHNNSHNNSHNNSHNNSHNNSHNNS 365 Query: 236 HNPLHS 219 HN H+ Sbjct: 366 HNNSHN 371 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/66 (39%), Positives = 41/66 (62%) Frame = -3 Query: 416 SSHSTSNKPKHNPSHSNNLNNKPTQNQSHFTSNKRNHNPSHSTSNKPNHNPSHSTSKKPN 237 +S++ S+ HN SH+N+ NN + N SH S+ +HN SH+ S+ +HN SH+ S + Sbjct: 304 NSYNNSHNNSHNNSHNNSHNN--SHNNSHNNSHNNSHNNSHNNSHNNSHNNSHNNSHNNS 361 Query: 236 HNPLHS 219 HN H+ Sbjct: 362 HNNSHN 367 >ref|NP_200198.1| early nodulin-like protein 1 [Arabidopsis thaliana] gi|10177249|dbj|BAB10717.1| unnamed protein product [Arabidopsis thaliana] gi|109946411|gb|ABG48384.1| At5g53870 [Arabidopsis thaliana] gi|332009038|gb|AED96421.1| early nodulin-like protein 1 [Arabidopsis thaliana] Length = 370 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/68 (41%), Positives = 38/68 (55%) Frame = -3 Query: 413 SHSTSNKPKHNPSHSNNLNNKPTQNQSHFTSNKRNHNPSHSTSNKPNHNPSHSTSKKPNH 234 SHS S+ P H PSHS +H S+ H PSHS ++ P+H+P+H+ S P H Sbjct: 218 SHSPSHSPAHTPSHS----------PAHTPSHSPAHAPSHSPAHAPSHSPAHAPSHSPAH 267 Query: 233 NPLHSTCT 210 +P HS T Sbjct: 268 SPSHSPAT 275 >ref|XP_011038297.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330 [Populus euphratica] Length = 648 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/86 (36%), Positives = 54/86 (62%), Gaps = 4/86 (4%) Frame = -3 Query: 248 KKPNHNPLHSTCTQVEYLCKSSKLQEALQLLETKSPDEIEVQTYSLLLHTCISKRSIQHG 69 K P+ N + T ++YL KS L EA+ L+E+ + +TYS LLH+CIS++S+ HG Sbjct: 27 KPPSKNSQNLNQT-LKYLTKSGNLDEAIHLIESSPSKFTDPETYSHLLHSCISQKSLHHG 85 Query: 68 ERIHRHLLR----SNLLKDPNLQRQI 3 +R+++ LL+ L++ NL+ ++ Sbjct: 86 QRVYKQLLKQEYSEKFLENHNLKSKL 111 >ref|XP_009136277.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Brassica rapa] Length = 503 Score = 59.3 bits (142), Expect = 1e-06 Identities = 42/149 (28%), Positives = 72/149 (48%), Gaps = 13/149 (8%) Frame = -3 Query: 410 HSTSNKPKHNPSHSN---NLNNKPTQNQS----HFTSNKRNHNPSHSTSNKPNHNP---- 264 HS ++ P P N ++ QNQS H + N +P H +P H P Sbjct: 59 HSVASYPP--PQRQNPPPGFDSHRFQNQSNTDHHRAPQRYNQSPQHG-GYRPQHAPRGGY 115 Query: 263 SHSTSKKPNH-NPLHSTCTQVEYLCKSSKLQEALQLLETKS-PDEIEVQTYSLLLHTCIS 90 + + PN N + T ++ LCK + ++A++LL+ + PD+ +SLL +C + Sbjct: 116 NQVNYQNPNQINEIAPTVEEIVRLCKLRRFKDAIELLDKGALPDK---DCFSLLFESCAN 172 Query: 89 KRSIQHGERIHRHLLRSNLLKDPNLQRQI 3 +S++H +++H H LRS DP L + Sbjct: 173 LKSLEHSKKVHDHFLRSVFRSDPKLNNVV 201 >gb|KFK25509.1| hypothetical protein AALP_AA8G124100 [Arabis alpina] Length = 541 Score = 59.3 bits (142), Expect = 1e-06 Identities = 35/132 (26%), Positives = 64/132 (48%), Gaps = 4/132 (3%) Frame = -3 Query: 386 HNPSHSNNLNNKPTQNQSHFTSNKRNHNPSHSTSNKPNHNPSHSTSKKPNHNPLHS---- 219 H NN N P Q Q+ +NH + + N S+ + N N + + Sbjct: 111 HRGGGGNNYQN-PGQYQNRAQQIPQNHGQYQNRPQQIPQNQSYPQQQPRNSNQIPNQVIP 169 Query: 218 TCTQVEYLCKSSKLQEALQLLETKSPDEIEVQTYSLLLHTCISKRSIQHGERIHRHLLRS 39 T +V +LCK + ++A++LL+ + + E +SLL +C + +S++H +++H H L+S Sbjct: 170 TVEEVMHLCKLRRYKDAIELLDKGALPDAEC--FSLLFESCGNLKSLEHSKKVHDHFLQS 227 Query: 38 NLLKDPNLQRQI 3 DP L + Sbjct: 228 KFRADPKLNNMV 239 >gb|AAZ54315.1| Surface protein from Gram-positive cocci, anchor region [Thermobifida fusca YX] Length = 302 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/69 (40%), Positives = 45/69 (65%), Gaps = 4/69 (5%) Frame = -3 Query: 413 SHSTSNKPKHNPSHSNNLNNKPTQNQSHFTSNKRNHNPSH--STSNKPNHNPSHS--TSK 246 SH ++ P H+P+HS+ + PT + +H S+K H+P+H + S+KP H+P+HS + Sbjct: 169 SHHPTHHPTHHPTHSHKPTHHPTHHPTH--SHKPTHHPTHHPTHSHKPTHHPTHSHKPTH 226 Query: 245 KPNHNPLHS 219 KP H+P HS Sbjct: 227 KPTHHPTHS 235 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 2/63 (3%) Frame = -3 Query: 401 SNKPKHNPSHSNNLNNKPTQNQSHFT--SNKRNHNPSHSTSNKPNHNPSHSTSKKPNHNP 228 S+KP H+P+H ++KPT + +H S+K H+P+H S+KP H P+H + P H+P Sbjct: 183 SHKPTHHPTHHPTHSHKPTHHPTHHPTHSHKPTHHPTH--SHKPTHKPTHHPTHSPTHSP 240 Query: 227 LHS 219 HS Sbjct: 241 THS 243 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/66 (40%), Positives = 44/66 (66%), Gaps = 4/66 (6%) Frame = -3 Query: 404 TSNKPKHNPSHSNNLNNKPTQNQSHFTSNKRNHNPSH--STSNKPNHNPSH--STSKKPN 237 T + P H+P+HS++ + PT + +H S+K H+P+H + S+KP H+P+H + S KP Sbjct: 158 THHHPTHHPTHSHHPTHHPTHHPTH--SHKPTHHPTHHPTHSHKPTHHPTHHPTHSHKPT 215 Query: 236 HNPLHS 219 H+P HS Sbjct: 216 HHPTHS 221 >dbj|BAD43029.1| predicted GPI-anchored protein [Arabidopsis thaliana] Length = 370 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/68 (41%), Positives = 38/68 (55%) Frame = -3 Query: 413 SHSTSNKPKHNPSHSNNLNNKPTQNQSHFTSNKRNHNPSHSTSNKPNHNPSHSTSKKPNH 234 SHS S+ P H PSHS +H S+ H PSHS ++ P+H+P+H+ S P H Sbjct: 218 SHSPSHSPAHTPSHS----------PAHTPSHSPAHAPSHSPAHAPSHSPAHAPSHSPAH 267 Query: 233 NPLHSTCT 210 +P HS T Sbjct: 268 SPSHSPAT 275 >ref|XP_009764432.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330-like [Nicotiana sylvestris] Length = 646 Score = 58.9 bits (141), Expect = 1e-06 Identities = 35/84 (41%), Positives = 50/84 (59%), Gaps = 5/84 (5%) Frame = -3 Query: 257 STSKKPNHNPLHSTCTQVEYLCKSSKLQEALQLLETKSPDEIE-VQTYSLLLHTCISKRS 81 S+ K N P T ++ L KS KL +AL LLE++ + E ++Y LLH CIS++S Sbjct: 19 SSFNKLNKTPPKPFNTNLKSLTKSGKLNDALLLLESQKNSQPENKESYLNLLHACISQKS 78 Query: 80 IQHGERIHRHLL----RSNLLKDP 21 ++HG R++ HLL RS L DP Sbjct: 79 LEHGHRLYLHLLLNPNRSKFLNDP 102 >ref|XP_011082278.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330 [Sesamum indicum] Length = 649 Score = 58.5 bits (140), Expect = 2e-06 Identities = 39/104 (37%), Positives = 62/104 (59%), Gaps = 9/104 (8%) Frame = -3 Query: 299 SHSTSNKPNHNPSHSTSKKPNHNPLHSTCTQVEYLCKSSKLQEALQLL----ETKSP-DE 135 S S +N P+ S + L+ST ++ L KS KL EAL LL ++++P + Sbjct: 7 SLSITNLTVTPPTKSLKQLRTQKSLNST---LKSLSKSGKLDEALHLLLESHQSRTPFGQ 63 Query: 134 IEVQTYSLLLHTCISKRSIQHGERIHRHLLRS----NLLKDPNL 15 +++Y+ LLH CIS++S+ HG R++ HLL+S +LLK+P L Sbjct: 64 PNLESYTTLLHACISRKSLSHGRRLYLHLLQSEDDTDLLKNPTL 107 >ref|XP_004288384.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330 [Fragaria vesca subsp. vesca] Length = 642 Score = 58.5 bits (140), Expect = 2e-06 Identities = 34/93 (36%), Positives = 58/93 (62%), Gaps = 8/93 (8%) Frame = -3 Query: 257 STSKKPNHNPLHSTCTQVEYLCKSSKLQEALQLLETKSPDEI-----EVQTYSLLLHTCI 93 S S P T + ++ L KS KL+EA++L+E SP ++ +++ YSLLLHTCI Sbjct: 16 SGSAIPQKPSKPQTPSTLKCLAKSGKLEEAIRLIEA-SPSKLTATQSDMEAYSLLLHTCI 74 Query: 92 SKRSIQHGERIHRHLLRSN---LLKDPNLQRQI 3 S++S++HG+R++ L S L+ +P L+ ++ Sbjct: 75 SQKSLEHGQRLYLQFLLSKHSLLVNNPTLKSKL 107 >ref|XP_011407990.1| PREDICTED: DNA-directed RNA polymerase II subunit 1-like [Amphimedon queenslandica] Length = 246 Score = 58.2 bits (139), Expect = 2e-06 Identities = 40/117 (34%), Positives = 54/117 (46%), Gaps = 3/117 (2%) Frame = -3 Query: 398 NKPKHNPSHSNNLNNKPTQNQSH-FTSNKRNHNPSHSTS-NKPNHNPSHSTS-KKPNHNP 228 N P H+PSHS + N+ PT SH ++ N H+PSHS S N P H+PSHS S P H P Sbjct: 84 NSPTHSPSHSYSYNS-PTHLPSHSYSYNSPTHSPSHSYSYNSPTHSPSHSYSYNSPTHLP 142 Query: 227 LHSTCTQVEYLCKSSKLQEALQLLETKSPDEIEVQTYSLLLHTCISKRSIQHGERIH 57 +H L + +P I + +Y+L H + S H H Sbjct: 143 IH---------------------LYSHNPSPIHLYSYNLPTH--LPSHSYSHNSPTH 176