BLASTX nr result
ID: Cinnamomum23_contig00029423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00029423 (283 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM86030.1| hypothetical protein ANO11243_040400 [fungal sp.... 181 2e-43 ref|XP_002487498.1| fumarate reductase Osm1, putative [Talaromyc... 178 1e-42 dbj|GAD94236.1| fumarate reductase Osm1, putative [Byssochlamys ... 178 1e-42 dbj|GAM33726.1| fumerate reductase [Talaromyces cellulolyticus] 177 2e-42 dbj|GAA89238.1| fumarate reductase Osm1 [Aspergillus kawachii IF... 177 3e-42 gb|EHA21461.1| hypothetical protein ASPNIDRAFT_205005 [Aspergill... 177 3e-42 ref|XP_001398015.1| fumarate reductase [Aspergillus niger CBS 51... 177 3e-42 ref|XP_002153010.1| fumarate reductase Osm1, putative [Talaromyc... 176 4e-42 gb|KKA23836.1| Fumarate reductase (NADH) [Rasamsonia emersonii C... 176 5e-42 emb|CRG91660.1| hypothetical protein PISL3812_08710 [Talaromyces... 176 7e-42 gb|KKK25831.1| hypothetical protein ARAM_000499 [Aspergillus ram... 175 9e-42 gb|KKK17293.1| hypothetical protein AOCH_001805 [Aspergillus och... 175 9e-42 ref|XP_001262094.1| fumarate reductase Osm1, putative [Neosartor... 175 9e-42 ref|XP_001276659.1| fumarate reductase Osm1, putative [Aspergill... 175 9e-42 emb|CEJ57746.1| Putative Fumarate reductase [Penicillium brasili... 174 3e-41 gb|KEY82817.1| fumarate reductase Osm1 [Aspergillus fumigatus va... 174 3e-41 ref|XP_747355.1| fumarate reductase Osm1 [Aspergillus fumigatus ... 174 3e-41 gb|EPS31495.1| hypothetical protein PDE_06450 [Penicillium oxali... 174 3e-41 ref|XP_001216364.1| hypothetical protein ATEG_07743 [Aspergillus... 174 3e-41 gb|KMU86684.1| fumarate reductase [Coccidioides immitis H538.4] 173 3e-41 >dbj|GAM86030.1| hypothetical protein ANO11243_040400 [fungal sp. No.11243] Length = 630 Score = 181 bits (459), Expect = 2e-43 Identities = 85/94 (90%), Positives = 90/94 (95%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKM+GKEL KEIGC EA Sbjct: 293 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMSGKELIKEIGCSEA 352 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFDDYNAIA+GKKKD +GKK+FHNLPF+ID Sbjct: 353 ALKKTFDDYNAIAEGKKKDPFGKKYFHNLPFNID 386 >ref|XP_002487498.1| fumarate reductase Osm1, putative [Talaromyces stipitatus ATCC 10500] gi|218713963|gb|EED13387.1| fumarate reductase Osm1, putative [Talaromyces stipitatus ATCC 10500] Length = 628 Score = 178 bits (452), Expect = 1e-42 Identities = 83/94 (88%), Positives = 89/94 (94%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSG+M+ EK++G+WPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA Sbjct: 293 DYVSGQMWKEKEKGKWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 352 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFDDYN IA+GKKKD W KKFFHNLPFSID Sbjct: 353 ALKKTFDDYNLIAEGKKKDPWNKKFFHNLPFSID 386 >dbj|GAD94236.1| fumarate reductase Osm1, putative [Byssochlamys spectabilis No. 5] Length = 643 Score = 178 bits (452), Expect = 1e-42 Identities = 81/94 (86%), Positives = 90/94 (95%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSG+M++EK++G+WPIRL+LNSKAS VLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA Sbjct: 296 DYVSGKMWEEKEKGKWPIRLILNSKASKVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 355 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFDDYN IADGK+KD WGKK+FHNLPFSID Sbjct: 356 ALKKTFDDYNQIADGKQKDPWGKKYFHNLPFSID 389 >dbj|GAM33726.1| fumerate reductase [Talaromyces cellulolyticus] Length = 628 Score = 177 bits (450), Expect = 2e-42 Identities = 83/94 (88%), Positives = 89/94 (94%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSG+M+ EK++ +WPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA Sbjct: 293 DYVSGQMWKEKEKKKWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 352 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFDDYN IA+GKKKD WGKKFFHNLPFSID Sbjct: 353 ALKKTFDDYNLIAEGKKKDPWGKKFFHNLPFSID 386 >dbj|GAA89238.1| fumarate reductase Osm1 [Aspergillus kawachii IFO 4308] Length = 633 Score = 177 bits (448), Expect = 3e-42 Identities = 81/94 (86%), Positives = 89/94 (94%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSG+M+ EK++G+WPIRL+LNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA Sbjct: 295 DYVSGQMWKEKEKGKWPIRLILNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 354 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFDDYN IA+GKKKD W K+FFHNLPFSID Sbjct: 355 ALKKTFDDYNLIAEGKKKDPWNKRFFHNLPFSID 388 >gb|EHA21461.1| hypothetical protein ASPNIDRAFT_205005 [Aspergillus niger ATCC 1015] Length = 633 Score = 177 bits (448), Expect = 3e-42 Identities = 81/94 (86%), Positives = 89/94 (94%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSG+M+ EK++G+WPIRL+LNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA Sbjct: 295 DYVSGQMWKEKEKGKWPIRLILNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 354 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFDDYN IA+GKKKD W K+FFHNLPFSID Sbjct: 355 ALKKTFDDYNLIAEGKKKDPWNKRFFHNLPFSID 388 >ref|XP_001398015.1| fumarate reductase [Aspergillus niger CBS 513.88] gi|134083573|emb|CAL00488.1| unnamed protein product [Aspergillus niger] Length = 629 Score = 177 bits (448), Expect = 3e-42 Identities = 81/94 (86%), Positives = 89/94 (94%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSG+M+ EK++G+WPIRL+LNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA Sbjct: 295 DYVSGQMWKEKEKGKWPIRLILNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 354 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFDDYN IA+GKKKD W K+FFHNLPFSID Sbjct: 355 ALKKTFDDYNLIAEGKKKDPWNKRFFHNLPFSID 388 >ref|XP_002153010.1| fumarate reductase Osm1, putative [Talaromyces marneffei ATCC 18224] gi|210064530|gb|EEA18625.1| fumarate reductase Osm1, putative [Talaromyces marneffei ATCC 18224] gi|680000792|gb|KFX52894.1| putative fumarate reductase [Talaromyces marneffei PM1] Length = 627 Score = 176 bits (447), Expect = 4e-42 Identities = 81/94 (86%), Positives = 89/94 (94%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSG+M+ EK++ +WPIRL+LNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA Sbjct: 293 DYVSGQMWKEKEKNKWPIRLILNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 352 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFD+YN IA+GKKKD WGKKFFHNLPFSID Sbjct: 353 ALKKTFDEYNLIAEGKKKDPWGKKFFHNLPFSID 386 >gb|KKA23836.1| Fumarate reductase (NADH) [Rasamsonia emersonii CBS 393.64] Length = 641 Score = 176 bits (446), Expect = 5e-42 Identities = 80/94 (85%), Positives = 90/94 (95%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSG+M+ EK++G+WPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTG+ELAKEIGCGEA Sbjct: 294 DYVSGQMWKEKEKGKWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGRELAKEIGCGEA 353 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFD+YN IA+GKKKD WGKK+FHN+PFSID Sbjct: 354 ALKKTFDEYNEIAEGKKKDPWGKKYFHNMPFSID 387 >emb|CRG91660.1| hypothetical protein PISL3812_08710 [Talaromyces islandicus] Length = 629 Score = 176 bits (445), Expect = 7e-42 Identities = 81/94 (86%), Positives = 89/94 (94%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSG+M+ EK++G+WPIRLVLNSKASNVLDFHTRHYSGRGLMKK+TGKELAKEIGCGEA Sbjct: 293 DYVSGQMWKEKEKGKWPIRLVLNSKASNVLDFHTRHYSGRGLMKKLTGKELAKEIGCGEA 352 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFD+YN IA+GKKKD W KKFFHNLPFSID Sbjct: 353 ALKKTFDEYNLIAEGKKKDPWNKKFFHNLPFSID 386 >gb|KKK25831.1| hypothetical protein ARAM_000499 [Aspergillus rambellii] Length = 626 Score = 175 bits (444), Expect = 9e-42 Identities = 81/94 (86%), Positives = 89/94 (94%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSG+M+ EK++ +WPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA Sbjct: 293 DYVSGQMWKEKEKNKWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 352 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFDDYNAIA+G+KKD WGK+FFHNLP SID Sbjct: 353 ALKKTFDDYNAIAEGQKKDPWGKRFFHNLPLSID 386 >gb|KKK17293.1| hypothetical protein AOCH_001805 [Aspergillus ochraceoroseus] Length = 626 Score = 175 bits (444), Expect = 9e-42 Identities = 81/94 (86%), Positives = 89/94 (94%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSG+M+ EK++ +WPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA Sbjct: 293 DYVSGQMWKEKEKNKWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 352 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFDDYNAIA+G+KKD WGK+FFHNLP SID Sbjct: 353 ALKKTFDDYNAIAEGQKKDPWGKRFFHNLPLSID 386 >ref|XP_001262094.1| fumarate reductase Osm1, putative [Neosartorya fischeri NRRL 181] gi|119410250|gb|EAW20197.1| fumarate reductase Osm1, putative [Neosartorya fischeri NRRL 181] Length = 630 Score = 175 bits (444), Expect = 9e-42 Identities = 80/94 (85%), Positives = 89/94 (94%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSG+M+ EK++G+WPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA Sbjct: 295 DYVSGQMWKEKEKGKWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 354 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFDDYN IA+GKKKD WGK+FFHN+PF I+ Sbjct: 355 ALKKTFDDYNLIAEGKKKDPWGKRFFHNMPFDIN 388 >ref|XP_001276659.1| fumarate reductase Osm1, putative [Aspergillus clavatus NRRL 1] gi|119404871|gb|EAW15233.1| fumarate reductase Osm1, putative [Aspergillus clavatus NRRL 1] Length = 629 Score = 175 bits (444), Expect = 9e-42 Identities = 80/94 (85%), Positives = 90/94 (95%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSG+M+ EK++G+WPIRLVLNSKASNVLDFHTRHYSGRGLM+KMTGKELAKEIGCGEA Sbjct: 295 DYVSGQMWKEKEKGKWPIRLVLNSKASNVLDFHTRHYSGRGLMRKMTGKELAKEIGCGEA 354 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFD+YNAIADGK+KD WGK+FFHNLPF I+ Sbjct: 355 ALKKTFDEYNAIADGKQKDPWGKRFFHNLPFEIN 388 >emb|CEJ57746.1| Putative Fumarate reductase [Penicillium brasilianum] Length = 628 Score = 174 bits (440), Expect = 3e-41 Identities = 81/94 (86%), Positives = 87/94 (92%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSG+M+ EK++G+WPIRLVLNSKAS VLDFHTRHYSGRGLMKKMTGKELA EIGCGEA Sbjct: 294 DYVSGQMWKEKEKGKWPIRLVLNSKASKVLDFHTRHYSGRGLMKKMTGKELAAEIGCGEA 353 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFD+YN IADGKKKD W KKFFHNLPFSID Sbjct: 354 ALKKTFDEYNLIADGKKKDPWNKKFFHNLPFSID 387 >gb|KEY82817.1| fumarate reductase Osm1 [Aspergillus fumigatus var. RP-2014] Length = 630 Score = 174 bits (440), Expect = 3e-41 Identities = 79/94 (84%), Positives = 89/94 (94%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSG+M+ EK++G+WPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA Sbjct: 295 DYVSGQMWKEKEKGKWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 354 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFD+YN IA+GKKKD WGK+FFHN+PF I+ Sbjct: 355 ALKKTFDEYNLIAEGKKKDPWGKRFFHNMPFDIN 388 >ref|XP_747355.1| fumarate reductase Osm1 [Aspergillus fumigatus Af293] gi|66844981|gb|EAL85317.1| fumarate reductase Osm1, putative [Aspergillus fumigatus Af293] gi|159123640|gb|EDP48759.1| fumarate reductase Osm1, putative [Aspergillus fumigatus A1163] gi|846910720|gb|KMK56619.1| fumarate reductase Osm1 [Aspergillus fumigatus Z5] Length = 630 Score = 174 bits (440), Expect = 3e-41 Identities = 79/94 (84%), Positives = 89/94 (94%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSG+M+ EK++G+WPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA Sbjct: 295 DYVSGQMWKEKEKGKWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 354 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFD+YN IA+GKKKD WGK+FFHN+PF I+ Sbjct: 355 ALKKTFDEYNLIAEGKKKDPWGKRFFHNMPFDIN 388 >gb|EPS31495.1| hypothetical protein PDE_06450 [Penicillium oxalicum 114-2] Length = 628 Score = 174 bits (440), Expect = 3e-41 Identities = 81/94 (86%), Positives = 87/94 (92%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSG+M+ EK++ +WPIRLVLNSKAS VLDFHTRHYSGRGLMKKMTGKELA EIGCGEA Sbjct: 294 DYVSGQMWKEKEKSKWPIRLVLNSKASKVLDFHTRHYSGRGLMKKMTGKELAAEIGCGEA 353 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFDDYN IA+GKKKD WGKKFFHNLPFSID Sbjct: 354 ALKKTFDDYNLIAEGKKKDPWGKKFFHNLPFSID 387 >ref|XP_001216364.1| hypothetical protein ATEG_07743 [Aspergillus terreus NIH2624] gi|114190305|gb|EAU32005.1| hypothetical protein ATEG_07743 [Aspergillus terreus NIH2624] Length = 626 Score = 174 bits (440), Expect = 3e-41 Identities = 79/94 (84%), Positives = 89/94 (94%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSG+M+ EK++G+WPIRLVLNSKASNVLDFHTRHYSGRGLM+KMTGKELAKEIGCGEA Sbjct: 295 DYVSGQMWKEKEKGKWPIRLVLNSKASNVLDFHTRHYSGRGLMRKMTGKELAKEIGCGEA 354 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFD+YN IA+GKKKD W K+FFHN+PFSID Sbjct: 355 ALKKTFDEYNLIAEGKKKDPWNKRFFHNMPFSID 388 >gb|KMU86684.1| fumarate reductase [Coccidioides immitis H538.4] Length = 392 Score = 173 bits (439), Expect = 3e-41 Identities = 79/94 (84%), Positives = 89/94 (94%) Frame = -2 Query: 282 DYVSGRMFDEKKEGRWPIRLVLNSKASNVLDFHTRHYSGRGLMKKMTGKELAKEIGCGEA 103 DYVSG M+ EK++G+WPIRL+LNSKASNVLDFHTRHYSGRGLMKKMTGKELA+EIGCGEA Sbjct: 56 DYVSGEMWKEKEKGKWPIRLILNSKASNVLDFHTRHYSGRGLMKKMTGKELAREIGCGEA 115 Query: 102 ALTKTFDDYNAIADGKKKDVWGKKFFHNLPFSID 1 AL KTFDDYN IA+GKKKD +GKK+FHNLPFS+D Sbjct: 116 ALKKTFDDYNQIAEGKKKDPFGKKYFHNLPFSVD 149