BLASTX nr result
ID: Cinnamomum23_contig00028996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00028996 (250 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006301496.1| hypothetical protein CARUB_v10021922mg, part... 59 1e-06 >ref|XP_006301496.1| hypothetical protein CARUB_v10021922mg, partial [Capsella rubella] gi|482570206|gb|EOA34394.1| hypothetical protein CARUB_v10021922mg, partial [Capsella rubella] Length = 882 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/51 (52%), Positives = 35/51 (68%) Frame = -3 Query: 248 CSPGGFPRLEFLELRQMPLVEEWIVEEGAMVSLKSVTLHRLSNLSKTTLPN 96 CS GGFP+L+ L L +P +EEW VEEG+M L ++ L R SNL K LP+ Sbjct: 780 CSDGGFPKLQILRLDSIPKLEEWTVEEGSMPCLHTLYLRRCSNLKKLPLPD 830