BLASTX nr result
ID: Cinnamomum23_contig00028800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00028800 (238 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005844115.1| hypothetical protein CHLNCDRAFT_139563 [Chlo... 76 8e-12 ref|XP_005643523.1| hypothetical protein COCSUDRAFT_68115 [Cocco... 67 4e-09 ref|XP_011398971.1| hypothetical protein F751_6226 [Auxenochlore... 65 2e-08 >ref|XP_005844115.1| hypothetical protein CHLNCDRAFT_139563 [Chlorella variabilis] gi|307103755|gb|EFN52013.1| hypothetical protein CHLNCDRAFT_139563 [Chlorella variabilis] Length = 258 Score = 76.3 bits (186), Expect = 8e-12 Identities = 36/78 (46%), Positives = 56/78 (71%) Frame = -1 Query: 235 DIRYILEAPKPTLSPDEYVKIPILENADRYQPARTAMLRPRPPKQSRAVPKSREDLFWEN 56 D+RYI+EAPK ++PDE V+IP+L + D + R + RPRPP Q R+VPK+ ++ FW+N Sbjct: 163 DLRYIMEAPKLQINPDERVQIPVLTDLDVNRGNRAPVARPRPP-QKRSVPKTWDEEFWDN 221 Query: 55 YRPPLQLPKNKYVQVASA 2 Y+ P + +N+YV A++ Sbjct: 222 YQGPGGVVQNRYVWAAAS 239 >ref|XP_005643523.1| hypothetical protein COCSUDRAFT_68115 [Coccomyxa subellipsoidea C-169] gi|384245485|gb|EIE18979.1| hypothetical protein COCSUDRAFT_68115 [Coccomyxa subellipsoidea C-169] Length = 203 Score = 67.4 bits (163), Expect = 4e-09 Identities = 39/82 (47%), Positives = 52/82 (63%), Gaps = 4/82 (4%) Frame = -1 Query: 238 ADIRYILEAPKPTLSPDEYVKIPILENADRYQPARTAMLRPRPPKQSRAVPKSR----ED 71 A++R+I+EAPK L PDE V IP++E ++R+ P R+ R R P SR + R E+ Sbjct: 108 ANLRFIMEAPKLRLGPDERVSIPVIETSNRFAPERS--FRTRTPPSSRKSGQQREMTWEE 165 Query: 70 LFWENYRPPLQLPKNKYVQVAS 5 +E YRPP QL NKYV VAS Sbjct: 166 RLFEEYRPP-QLVPNKYVLVAS 186 >ref|XP_011398971.1| hypothetical protein F751_6226 [Auxenochlorella protothecoides] gi|675353635|gb|KFM26075.1| hypothetical protein F751_6226 [Auxenochlorella protothecoides] Length = 258 Score = 64.7 bits (156), Expect = 2e-08 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 1/80 (1%) Frame = -1 Query: 238 ADIRYILEAPKPTLSPDEYVKIPILENADRYQPARTAMLRPR-PPKQSRAVPKSREDLFW 62 AD+RYI+EAPK LS + V IP+L+N D + R RPR PP + K+ ++ FW Sbjct: 158 ADLRYIMEAPKLPLSDKDRVHIPVLKNMDVNRGVRAPTNRPRAPPTTASKREKTWDERFW 217 Query: 61 ENYRPPLQLPKNKYVQVASA 2 E Y PP Q NKYV AS+ Sbjct: 218 ETYEPP-QYLTNKYVWFASS 236