BLASTX nr result
ID: Cinnamomum23_contig00028742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00028742 (269 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62375.1| hypothetical protein VITISV_028920 [Vitis vinifera] 40 4e-06 >emb|CAN62375.1| hypothetical protein VITISV_028920 [Vitis vinifera] Length = 843 Score = 39.7 bits (91), Expect(2) = 4e-06 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = -3 Query: 153 KAPIGGSRGKVMWRLSFLAVIWTIRKERNSRCFEGIVSSESI 28 + P G + K +W+ L + WT+ KERN F G+ S+ES+ Sbjct: 507 RGPFVGKKRKKIWKSIPLYIFWTVWKERNRLAFRGVCSNESV 548 Score = 37.4 bits (85), Expect(2) = 4e-06 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -2 Query: 268 VDHLLLSCKTAQSIWMSMVLGFGYCWVLPNSL-KLFQDWEGP 146 VDHLL+ C + +W ++ FG WV P ++ K+ W GP Sbjct: 468 VDHLLIHCIVVRVLWDLVLALFGVHWVFPETVKKVLLSWRGP 509