BLASTX nr result
ID: Cinnamomum23_contig00028395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00028395 (562 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010266797.1| PREDICTED: putative uncharacterized protein ... 64 6e-08 >ref|XP_010266797.1| PREDICTED: putative uncharacterized protein At4g01020, chloroplastic [Nelumbo nucifera] Length = 1748 Score = 63.5 bits (153), Expect = 6e-08 Identities = 34/67 (50%), Positives = 41/67 (61%) Frame = -2 Query: 201 GRPPFYIELLSGHRPWRKPDVEDLIGDCPSTPYFSFAFSSGHLAARVFFWQRTDALEATA 22 GR F +EL SG R K DVE L+ C STP F + +AAR++F Q +DALEA Sbjct: 60 GRSNFVVELRSGRRAITKSDVEVLLAGCASTPERCEVFPTVLVAARLYFQQWSDALEALT 119 Query: 21 FFWSRRL 1 FFW RRL Sbjct: 120 FFWERRL 126