BLASTX nr result
ID: Cinnamomum23_contig00028231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00028231 (445 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010694943.1| PREDICTED: UV radiation resistance-associate... 79 9e-13 ref|XP_010694941.1| PREDICTED: UV radiation resistance-associate... 79 9e-13 ref|XP_002518075.1| conserved hypothetical protein [Ricinus comm... 79 1e-12 ref|XP_006373062.1| hypothetical protein POPTR_0017s08370g [Popu... 79 1e-12 ref|XP_002323989.2| hypothetical protein POPTR_0017s08370g [Popu... 79 1e-12 gb|KDO44897.1| hypothetical protein CISIN_1g018202mg [Citrus sin... 79 2e-12 gb|KDO44896.1| hypothetical protein CISIN_1g018202mg [Citrus sin... 79 2e-12 gb|KDO44894.1| hypothetical protein CISIN_1g018202mg [Citrus sin... 79 2e-12 gb|KDO44893.1| hypothetical protein CISIN_1g018202mg [Citrus sin... 79 2e-12 ref|XP_006489817.1| PREDICTED: UV radiation resistance-associate... 79 2e-12 ref|XP_006489816.1| PREDICTED: UV radiation resistance-associate... 79 2e-12 ref|XP_006420994.1| hypothetical protein CICLE_v10005271mg [Citr... 79 2e-12 ref|XP_006420993.1| hypothetical protein CICLE_v10005271mg [Citr... 79 2e-12 ref|XP_006420991.1| hypothetical protein CICLE_v10005271mg [Citr... 79 2e-12 ref|XP_008457231.1| PREDICTED: UV radiation resistance-associate... 78 3e-12 ref|XP_010650285.1| PREDICTED: UV radiation resistance-associate... 77 3e-12 ref|XP_002273954.1| PREDICTED: UV radiation resistance-associate... 77 3e-12 ref|XP_004139009.1| PREDICTED: UV radiation resistance-associate... 77 4e-12 ref|XP_012481719.1| PREDICTED: UV radiation resistance-associate... 76 8e-12 ref|XP_011006961.1| PREDICTED: UV radiation resistance-associate... 76 8e-12 >ref|XP_010694943.1| PREDICTED: UV radiation resistance-associated gene protein isoform X3 [Beta vulgaris subsp. vulgaris] gi|870845245|gb|KMS98016.1| hypothetical protein BVRB_4g096440 isoform B [Beta vulgaris subsp. vulgaris] Length = 273 Score = 79.3 bits (194), Expect = 9e-13 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFIDS 310 AIFLLNKDIEQLLN+VGI+SLGPRHVLANLKELF+TI S EFI+S Sbjct: 228 AIFLLNKDIEQLLNYVGIESLGPRHVLANLKELFKTILSPEFIES 272 >ref|XP_010694941.1| PREDICTED: UV radiation resistance-associated gene protein isoform X1 [Beta vulgaris subsp. vulgaris] gi|870845244|gb|KMS98015.1| hypothetical protein BVRB_4g096440 isoform A [Beta vulgaris subsp. vulgaris] Length = 362 Score = 79.3 bits (194), Expect = 9e-13 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFIDS 310 AIFLLNKDIEQLLN+VGI+SLGPRHVLANLKELF+TI S EFI+S Sbjct: 317 AIFLLNKDIEQLLNYVGIESLGPRHVLANLKELFKTILSPEFIES 361 >ref|XP_002518075.1| conserved hypothetical protein [Ricinus communis] gi|223542671|gb|EEF44208.1| conserved hypothetical protein [Ricinus communis] Length = 356 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFIDS 310 A+FLLNKD+EQLLN++GI+SLGPRHVLANLKEL RTIQS EF+D+ Sbjct: 312 AVFLLNKDLEQLLNYIGIKSLGPRHVLANLKELIRTIQSAEFLDT 356 >ref|XP_006373062.1| hypothetical protein POPTR_0017s08370g [Populus trichocarpa] gi|550319767|gb|ERP50859.1| hypothetical protein POPTR_0017s08370g [Populus trichocarpa] Length = 356 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFIDS 310 A+FLLNKD+EQLLN++G++SLGPRHVLANLKEL RTIQS EF+DS Sbjct: 312 AVFLLNKDLEQLLNYIGVRSLGPRHVLANLKELTRTIQSAEFLDS 356 >ref|XP_002323989.2| hypothetical protein POPTR_0017s08370g [Populus trichocarpa] gi|550319766|gb|EEF04122.2| hypothetical protein POPTR_0017s08370g [Populus trichocarpa] Length = 352 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFIDS 310 A+FLLNKD+EQLLN++G++SLGPRHVLANLKEL RTIQS EF+DS Sbjct: 308 AVFLLNKDLEQLLNYIGVRSLGPRHVLANLKELTRTIQSAEFLDS 352 >gb|KDO44897.1| hypothetical protein CISIN_1g018202mg [Citrus sinensis] Length = 203 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFIDS 310 A+FLLNKDIEQLLN++G++SLGPRHVLANLKEL RTIQS E+ID+ Sbjct: 159 AVFLLNKDIEQLLNYIGVKSLGPRHVLANLKELLRTIQSPEYIDT 203 >gb|KDO44896.1| hypothetical protein CISIN_1g018202mg [Citrus sinensis] Length = 199 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFIDS 310 A+FLLNKDIEQLLN++G++SLGPRHVLANLKEL RTIQS E+ID+ Sbjct: 155 AVFLLNKDIEQLLNYIGVKSLGPRHVLANLKELLRTIQSPEYIDT 199 >gb|KDO44894.1| hypothetical protein CISIN_1g018202mg [Citrus sinensis] gi|641825633|gb|KDO44895.1| hypothetical protein CISIN_1g018202mg [Citrus sinensis] Length = 278 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFIDS 310 A+FLLNKDIEQLLN++G++SLGPRHVLANLKEL RTIQS E+ID+ Sbjct: 234 AVFLLNKDIEQLLNYIGVKSLGPRHVLANLKELLRTIQSPEYIDT 278 >gb|KDO44893.1| hypothetical protein CISIN_1g018202mg [Citrus sinensis] Length = 359 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFIDS 310 A+FLLNKDIEQLLN++G++SLGPRHVLANLKEL RTIQS E+ID+ Sbjct: 315 AVFLLNKDIEQLLNYIGVKSLGPRHVLANLKELLRTIQSPEYIDT 359 >ref|XP_006489817.1| PREDICTED: UV radiation resistance-associated gene protein-like isoform X2 [Citrus sinensis] Length = 279 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFIDS 310 A+FLLNKDIEQLLN++G++SLGPRHVLANLKEL RTIQS E+ID+ Sbjct: 235 AVFLLNKDIEQLLNYIGVKSLGPRHVLANLKELLRTIQSPEYIDT 279 >ref|XP_006489816.1| PREDICTED: UV radiation resistance-associated gene protein-like isoform X1 [Citrus sinensis] Length = 360 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFIDS 310 A+FLLNKDIEQLLN++G++SLGPRHVLANLKEL RTIQS E+ID+ Sbjct: 316 AVFLLNKDIEQLLNYIGVKSLGPRHVLANLKELLRTIQSPEYIDT 360 >ref|XP_006420994.1| hypothetical protein CICLE_v10005271mg [Citrus clementina] gi|557522867|gb|ESR34234.1| hypothetical protein CICLE_v10005271mg [Citrus clementina] Length = 203 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFIDS 310 A+FLLNKDIEQLLN++G++SLGPRHVLANLKEL RTIQS E+ID+ Sbjct: 159 AVFLLNKDIEQLLNYIGVKSLGPRHVLANLKELLRTIQSPEYIDT 203 >ref|XP_006420993.1| hypothetical protein CICLE_v10005271mg [Citrus clementina] gi|557522866|gb|ESR34233.1| hypothetical protein CICLE_v10005271mg [Citrus clementina] Length = 278 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFIDS 310 A+FLLNKDIEQLLN++G++SLGPRHVLANLKEL RTIQS E+ID+ Sbjct: 234 AVFLLNKDIEQLLNYIGVKSLGPRHVLANLKELLRTIQSPEYIDT 278 >ref|XP_006420991.1| hypothetical protein CICLE_v10005271mg [Citrus clementina] gi|557522864|gb|ESR34231.1| hypothetical protein CICLE_v10005271mg [Citrus clementina] Length = 357 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFIDS 310 A+FLLNKDIEQLLN++G++SLGPRHVLANLKEL RTIQS E+ID+ Sbjct: 313 AVFLLNKDIEQLLNYIGVKSLGPRHVLANLKELLRTIQSPEYIDT 357 >ref|XP_008457231.1| PREDICTED: UV radiation resistance-associated gene protein isoform X1 [Cucumis melo] Length = 361 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFID 313 A+FLLNKD+EQLLNF+G++SLGPRH+LANLKELFR IQS ++ID Sbjct: 317 AVFLLNKDLEQLLNFIGVKSLGPRHILANLKELFRVIQSADYID 360 >ref|XP_010650285.1| PREDICTED: UV radiation resistance-associated gene protein isoform X2 [Vitis vinifera] Length = 278 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFIDS 310 A+FLLNKD+EQLLNF+G++SLGPRHVLANLKEL RTI S EFID+ Sbjct: 234 AVFLLNKDLEQLLNFIGVKSLGPRHVLANLKELLRTILSPEFIDT 278 >ref|XP_002273954.1| PREDICTED: UV radiation resistance-associated gene protein isoform X1 [Vitis vinifera] gi|298205154|emb|CBI17213.3| unnamed protein product [Vitis vinifera] Length = 345 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFIDS 310 A+FLLNKD+EQLLNF+G++SLGPRHVLANLKEL RTI S EFID+ Sbjct: 301 AVFLLNKDLEQLLNFIGVKSLGPRHVLANLKELLRTILSPEFIDT 345 >ref|XP_004139009.1| PREDICTED: UV radiation resistance-associated gene protein [Cucumis sativus] gi|700206360|gb|KGN61479.1| hypothetical protein Csa_2G139810 [Cucumis sativus] Length = 359 Score = 77.0 bits (188), Expect = 4e-12 Identities = 33/44 (75%), Positives = 42/44 (95%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFID 313 A+FLLNKD+EQLLNF+G++SLGPRH+LANLKE+FR IQS ++ID Sbjct: 315 AVFLLNKDLEQLLNFIGVKSLGPRHILANLKEIFRVIQSADYID 358 >ref|XP_012481719.1| PREDICTED: UV radiation resistance-associated gene protein-like isoform X3 [Gossypium raimondii] gi|763760868|gb|KJB28122.1| hypothetical protein B456_005G031400 [Gossypium raimondii] Length = 360 Score = 76.3 bits (186), Expect = 8e-12 Identities = 34/45 (75%), Positives = 42/45 (93%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFIDS 310 A+FLLNKD+EQLLNF+G++SLGPRHVLANLKEL R +QS E+ID+ Sbjct: 316 AVFLLNKDMEQLLNFIGVKSLGPRHVLANLKELLRCVQSSEYIDT 360 >ref|XP_011006961.1| PREDICTED: UV radiation resistance-associated gene protein-like isoform X4 [Populus euphratica] Length = 225 Score = 76.3 bits (186), Expect = 8e-12 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -2 Query: 444 AIFLLNKDIEQLLNFVGIQSLGPRHVLANLKELFRTIQSREFIDS 310 A+FLLNKD++QLLN++G +SLGPRHVLANLKEL RTIQS EF+DS Sbjct: 181 AVFLLNKDLDQLLNYIGARSLGPRHVLANLKELTRTIQSAEFLDS 225