BLASTX nr result
ID: Cinnamomum23_contig00028107
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00028107 (603 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU14900.1| unknown [Glycine max] 67 7e-09 >gb|ACU14900.1| unknown [Glycine max] Length = 70 Score = 67.0 bits (162), Expect = 7e-09 Identities = 31/58 (53%), Positives = 37/58 (63%) Frame = +3 Query: 168 GAP*PRNGLPLEGET*MVSLSLWNPCLNTPNPNSKPIKTTTRIKHVHILHMVPVQHIL 341 G P P P E + VSL LWNPCLNTPNPN+ P+ TTR KHV + +P QHI+ Sbjct: 3 GLPPPAAPPPQESQKLTVSLILWNPCLNTPNPNNNPMAITTRTKHVQSMQTLPPQHIV 60