BLASTX nr result
ID: Cinnamomum23_contig00028025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00028025 (230 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010463125.1| PREDICTED: somatic embryogenesis receptor ki... 57 6e-06 ref|XP_010261130.1| PREDICTED: somatic embryogenesis receptor ki... 56 8e-06 >ref|XP_010463125.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Camelina sativa] Length = 573 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +2 Query: 119 LECLCKDSRLNNNSLSGSIPMSLTNISALQVLDLSNN 229 L+ DSRLNNNSL+G IP+SLTNI+ LQVLDLSNN Sbjct: 130 LQAALSDSRLNNNSLTGPIPLSLTNITTLQVLDLSNN 166 >ref|XP_010261130.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Nelumbo nucifera] Length = 627 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 143 RLNNNSLSGSIPMSLTNISALQVLDLSNN 229 RLNNNSLSG IPMSLTN+SALQVLDLSNN Sbjct: 149 RLNNNSLSGQIPMSLTNVSALQVLDLSNN 177