BLASTX nr result
ID: Cinnamomum23_contig00028019
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00028019 (296 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008801174.1| PREDICTED: pentatricopeptide repeat-containi... 79 9e-13 >ref|XP_008801174.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Phoenix dactylifera] Length = 622 Score = 79.3 bits (194), Expect = 9e-13 Identities = 35/57 (61%), Positives = 46/57 (80%) Frame = -3 Query: 171 KKPSSIPSTELGLLLQTCIETKSYQQGKSIHSQILKLGFERNRDLLPKLIKLYSVCG 1 K I S E G+LLQ+CI+ +S++QGK +HS+I + GFE+NRDLLPKL+KLYSVCG Sbjct: 38 KNCQPITSAEFGVLLQSCIDVRSFEQGKRLHSRIREAGFEKNRDLLPKLVKLYSVCG 94