BLASTX nr result
ID: Cinnamomum23_contig00027493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00027493 (275 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44643.1| hypothetical protein MIMGU_mgv1a006427mg [Erythra... 93 6e-17 ref|XP_012854841.1| PREDICTED: ubiquitin receptor RAD23c-like is... 89 1e-15 ref|XP_012854833.1| PREDICTED: ubiquitin receptor RAD23c-like is... 89 1e-15 ref|XP_009607598.1| PREDICTED: ubiquitin receptor RAD23c-like is... 88 2e-15 ref|XP_009607597.1| PREDICTED: ubiquitin receptor RAD23d-like is... 88 2e-15 ref|XP_006367045.1| PREDICTED: ubiquitin receptor RAD23c-like [S... 87 6e-15 ref|XP_007033285.1| Rad23 UV excision repair protein family isof... 87 6e-15 ref|XP_007033284.1| Rad23 UV excision repair protein family isof... 87 6e-15 ref|XP_004236965.1| PREDICTED: ubiquitin receptor RAD23c [Solanu... 87 6e-15 ref|XP_010549930.1| PREDICTED: ubiquitin receptor RAD23c-like [T... 86 1e-14 ref|XP_008243218.1| PREDICTED: ubiquitin receptor RAD23d-like [P... 86 1e-14 ref|XP_007227719.1| hypothetical protein PRUPE_ppa007047mg [Prun... 86 1e-14 ref|XP_011097188.1| PREDICTED: ubiquitin receptor RAD23c-like [S... 85 2e-14 ref|XP_009791275.1| PREDICTED: ubiquitin receptor RAD23c-like is... 85 2e-14 ref|XP_009791274.1| PREDICTED: ubiquitin receptor RAD23c-like is... 85 2e-14 ref|XP_009631151.1| PREDICTED: ubiquitin receptor RAD23c-like is... 85 2e-14 ref|XP_009631150.1| PREDICTED: ubiquitin receptor RAD23d-like is... 85 2e-14 ref|XP_010103794.1| Putative DNA repair protein RAD23-4 [Morus n... 85 2e-14 ref|XP_011099561.1| PREDICTED: ubiquitin receptor RAD23c-like [S... 85 2e-14 ref|XP_010317192.1| PREDICTED: ubiquitin receptor RAD23d isoform... 85 2e-14 >gb|EYU44643.1| hypothetical protein MIMGU_mgv1a006427mg [Erythranthe guttata] Length = 444 Score = 93.2 bits (230), Expect = 6e-17 Identities = 52/82 (63%), Positives = 60/82 (73%), Gaps = 3/82 (3%) Frame = -3 Query: 237 SLQYPHTRIHRRRRANQATPFSGDRT*TESK---SQKMKIFVKTLKGTHFEIEVKPDDTV 67 S +P + RR++ T FSG + T+ S MKIFVKTLKGTHFEIEVKP+DTV Sbjct: 31 SSSHPTHTVGGGRRSD--TRFSGGKLRTKRSTISSNSMKIFVKTLKGTHFEIEVKPEDTV 88 Query: 66 ADVKKNVETSQGSDIYPAAQQM 1 ADVKKNVET QGSD+YPAAQQM Sbjct: 89 ADVKKNVETVQGSDVYPAAQQM 110 >ref|XP_012854841.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Erythranthe guttatus] Length = 363 Score = 88.6 bits (218), Expect = 1e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 135 MKIFVKTLKGTHFEIEVKPDDTVADVKKNVETSQGSDIYPAAQQM 1 MKIFVKTLKGTHFEIEVKP+DTVADVKKNVET QGSD+YPAAQQM Sbjct: 1 MKIFVKTLKGTHFEIEVKPEDTVADVKKNVETVQGSDVYPAAQQM 45 >ref|XP_012854833.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Erythranthe guttatus] Length = 379 Score = 88.6 bits (218), Expect = 1e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 135 MKIFVKTLKGTHFEIEVKPDDTVADVKKNVETSQGSDIYPAAQQM 1 MKIFVKTLKGTHFEIEVKP+DTVADVKKNVET QGSD+YPAAQQM Sbjct: 1 MKIFVKTLKGTHFEIEVKPEDTVADVKKNVETVQGSDVYPAAQQM 45 >ref|XP_009607598.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana tomentosiformis] Length = 365 Score = 88.2 bits (217), Expect = 2e-15 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -3 Query: 135 MKIFVKTLKGTHFEIEVKPDDTVADVKKNVETSQGSDIYPAAQQM 1 MKIFVKTLKGTHFEIEVKP+DTVADVKKN+ET+QG DIYPAAQQM Sbjct: 1 MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQDIYPAAQQM 45 >ref|XP_009607597.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana tomentosiformis] Length = 383 Score = 88.2 bits (217), Expect = 2e-15 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -3 Query: 135 MKIFVKTLKGTHFEIEVKPDDTVADVKKNVETSQGSDIYPAAQQM 1 MKIFVKTLKGTHFEIEVKP+DTVADVKKN+ET+QG DIYPAAQQM Sbjct: 1 MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQDIYPAAQQM 45 >ref|XP_006367045.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum] Length = 398 Score = 86.7 bits (213), Expect = 6e-15 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -3 Query: 135 MKIFVKTLKGTHFEIEVKPDDTVADVKKNVETSQGSDIYPAAQQM 1 MKIFVKTLKG+HFEIEVKP+DTVADVKKN+ET QGSD+YPAAQQM Sbjct: 1 MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAAQQM 45 >ref|XP_007033285.1| Rad23 UV excision repair protein family isoform 2 [Theobroma cacao] gi|508712314|gb|EOY04211.1| Rad23 UV excision repair protein family isoform 2 [Theobroma cacao] Length = 350 Score = 86.7 bits (213), Expect = 6e-15 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -3 Query: 135 MKIFVKTLKGTHFEIEVKPDDTVADVKKNVETSQGSDIYPAAQQM 1 MKIFVKTLKGTHFEIEVKP+DTVADVKKN++T+QG DIYPAAQQM Sbjct: 1 MKIFVKTLKGTHFEIEVKPEDTVADVKKNIDTAQGPDIYPAAQQM 45 >ref|XP_007033284.1| Rad23 UV excision repair protein family isoform 1 [Theobroma cacao] gi|508712313|gb|EOY04210.1| Rad23 UV excision repair protein family isoform 1 [Theobroma cacao] Length = 487 Score = 86.7 bits (213), Expect = 6e-15 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -3 Query: 135 MKIFVKTLKGTHFEIEVKPDDTVADVKKNVETSQGSDIYPAAQQM 1 MKIFVKTLKGTHFEIEVKP+DTVADVKKN++T+QG DIYPAAQQM Sbjct: 1 MKIFVKTLKGTHFEIEVKPEDTVADVKKNIDTAQGPDIYPAAQQM 45 >ref|XP_004236965.1| PREDICTED: ubiquitin receptor RAD23c [Solanum lycopersicum] Length = 409 Score = 86.7 bits (213), Expect = 6e-15 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -3 Query: 135 MKIFVKTLKGTHFEIEVKPDDTVADVKKNVETSQGSDIYPAAQQM 1 MKIFVKTLKG+HFEIEVKP+DTVADVKKN+ET QGSD+YPAAQQM Sbjct: 1 MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAAQQM 45 >ref|XP_010549930.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana] gi|90657579|gb|ABD96879.1| hypothetical protein [Cleome spinosa] Length = 383 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -3 Query: 135 MKIFVKTLKGTHFEIEVKPDDTVADVKKNVETSQGSDIYPAAQQM 1 MKIFVKTLKGTHFEIEVKP+DTVADVKKN+ET QG+D+YP+AQQM Sbjct: 1 MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQGADVYPSAQQM 45 >ref|XP_008243218.1| PREDICTED: ubiquitin receptor RAD23d-like [Prunus mume] Length = 384 Score = 85.5 bits (210), Expect = 1e-14 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -3 Query: 135 MKIFVKTLKGTHFEIEVKPDDTVADVKKNVETSQGSDIYPAAQQM 1 MKIFVKTLKGTHF++EVKP+DTVADVKK +ETSQGSD+YPA+QQM Sbjct: 1 MKIFVKTLKGTHFDVEVKPEDTVADVKKQIETSQGSDVYPASQQM 45 >ref|XP_007227719.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica] gi|645276294|ref|XP_008243219.1| PREDICTED: ubiquitin receptor RAD23c-like [Prunus mume] gi|462424655|gb|EMJ28918.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica] Length = 385 Score = 85.5 bits (210), Expect = 1e-14 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -3 Query: 135 MKIFVKTLKGTHFEIEVKPDDTVADVKKNVETSQGSDIYPAAQQM 1 MKIFVKTLKGTHF++EVKP+DTVADVKK +ETSQGSD+YPA+QQM Sbjct: 1 MKIFVKTLKGTHFDVEVKPEDTVADVKKQIETSQGSDVYPASQQM 45 >ref|XP_011097188.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum] Length = 380 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 135 MKIFVKTLKGTHFEIEVKPDDTVADVKKNVETSQGSDIYPAAQQM 1 MKIFVKTLKG+HFEIEVKP+DTVADVKKN+ET QGSD+YPA QQM Sbjct: 1 MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQM 45 >ref|XP_009791275.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana sylvestris] Length = 377 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 135 MKIFVKTLKGTHFEIEVKPDDTVADVKKNVETSQGSDIYPAAQQM 1 MKIFVKTLKG+HFEIEVKP+DTVADVKKN+ET QGSD+YPA QQM Sbjct: 1 MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQM 45 >ref|XP_009791274.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana sylvestris] Length = 395 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 135 MKIFVKTLKGTHFEIEVKPDDTVADVKKNVETSQGSDIYPAAQQM 1 MKIFVKTLKG+HFEIEVKP+DTVADVKKN+ET QGSD+YPA QQM Sbjct: 1 MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQM 45 >ref|XP_009631151.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana tomentosiformis] Length = 377 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 135 MKIFVKTLKGTHFEIEVKPDDTVADVKKNVETSQGSDIYPAAQQM 1 MKIFVKTLKG+HFEIEVKP+DTVADVKKN+ET QGSD+YPA QQM Sbjct: 1 MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQM 45 >ref|XP_009631150.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana tomentosiformis] Length = 395 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 135 MKIFVKTLKGTHFEIEVKPDDTVADVKKNVETSQGSDIYPAAQQM 1 MKIFVKTLKG+HFEIEVKP+DTVADVKKN+ET QGSD+YPA QQM Sbjct: 1 MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQM 45 >ref|XP_010103794.1| Putative DNA repair protein RAD23-4 [Morus notabilis] gi|587909238|gb|EXB97156.1| Putative DNA repair protein RAD23-4 [Morus notabilis] Length = 550 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = -3 Query: 150 SKSQKMKIFVKTLKGTHFEIEVKPDDTVADVKKNVETSQGSDIYPAAQQM 1 S +KMKI VKTLKGTHFEIEVKP+DTVADVKKN+E QG+D+YPA+QQM Sbjct: 113 SSKKKMKICVKTLKGTHFEIEVKPEDTVADVKKNIEVVQGADVYPASQQM 162 >ref|XP_011099561.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum] Length = 380 Score = 84.7 bits (208), Expect = 2e-14 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = -3 Query: 135 MKIFVKTLKGTHFEIEVKPDDTVADVKKNVETSQGSDIYPAAQQM 1 M+IFVKTLKGTHFEIEVKP+DTVADVKKN+ET QG+D+YPA+QQM Sbjct: 1 MRIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQGADVYPASQQM 45 >ref|XP_010317192.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Solanum lycopersicum] Length = 381 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 135 MKIFVKTLKGTHFEIEVKPDDTVADVKKNVETSQGSDIYPAAQQM 1 MKIFVKTLKGTHFEIEVKP+DTVADVKK++ET QG D+YPAAQQM Sbjct: 1 MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQM 45