BLASTX nr result
ID: Cinnamomum23_contig00027481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00027481 (392 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value prf||1211235CE ORF 79 53 1e-12 ref|NP_054546.1| hypothetical protein NitaCp072 [Nicotiana tabac... 53 1e-12 ref|YP_001109547.1| hypothetical protein Poptr_cp068 [Populus tr... 65 2e-11 >prf||1211235CE ORF 79 Length = 79 Score = 53.1 bits (126), Expect(3) = 1e-12 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +1 Query: 13 SIDRSCHIGPSRTSNCFDLNYPEDTL 90 SIDRSCHIGPS TSNCFDLNYPE+ + Sbjct: 11 SIDRSCHIGPSWTSNCFDLNYPENAM 36 Score = 40.0 bits (92), Expect(3) = 1e-12 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = +3 Query: 144 KEVNMVPK*R*ICKKQVRLRLFLILNGM 227 KEVN VP ICKKQVRLR+FLILNGM Sbjct: 54 KEVNRVPIE--ICKKQVRLRVFLILNGM 79 Score = 25.8 bits (55), Expect(3) = 1e-12 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +2 Query: 98 QKDVQSNLFLDSIE 139 QKD QSNLFLDS++ Sbjct: 41 QKDGQSNLFLDSLK 54 >ref|NP_054546.1| hypothetical protein NitaCp072 [Nicotiana tabacum] gi|11466029|ref|NP_054571.1| hypothetical protein NitaCp098 [Nicotiana tabacum] gi|78102586|ref|YP_358726.1| hypothetical protein NisyCp082 [Nicotiana sylvestris] gi|78102613|ref|YP_358752.1| hypothetical protein NisyCp111 [Nicotiana sylvestris] gi|81301616|ref|YP_398912.1| hypothetical protein NitoCp081 [Nicotiana tomentosiformis] gi|81301643|ref|YP_398938.1| hypothetical protein NitoCp109 [Nicotiana tomentosiformis] gi|351653909|ref|YP_004891655.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653954|ref|YP_004891681.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|4388760|emb|CAA77389.1| hypothetical protein [Nicotiana tabacum] gi|4388762|emb|CAA77404.1| hypothetical protein [Nicotiana tabacum] gi|77799613|dbj|BAE46702.1| hypothetical protein [Nicotiana sylvestris] gi|77799640|dbj|BAE46729.1| hypothetical protein [Nicotiana sylvestris] gi|80750975|dbj|BAE48051.1| hypothetical protein [Nicotiana tomentosiformis] gi|80751002|dbj|BAE48078.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453935|gb|AEO95593.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453980|gb|AEO95638.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454046|gb|AEO95703.1| hypothetical protein [synthetic construct] gi|347454089|gb|AEO95746.1| hypothetical protein [synthetic construct] Length = 79 Score = 53.1 bits (126), Expect(3) = 1e-12 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +1 Query: 13 SIDRSCHIGPSRTSNCFDLNYPEDTL 90 SIDRSCHIGPS TSNCFDLNYPE+ + Sbjct: 11 SIDRSCHIGPSWTSNCFDLNYPENAM 36 Score = 40.0 bits (92), Expect(3) = 1e-12 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = +3 Query: 144 KEVNMVPK*R*ICKKQVRLRLFLILNGM 227 KEVN VP ICKKQVRLR+FLILNGM Sbjct: 54 KEVNRVPIE--ICKKQVRLRVFLILNGM 79 Score = 25.8 bits (55), Expect(3) = 1e-12 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +2 Query: 98 QKDVQSNLFLDSIE 139 QKD QSNLFLDS++ Sbjct: 41 QKDGQSNLFLDSLK 54 >ref|YP_001109547.1| hypothetical protein Poptr_cp068 [Populus trichocarpa] gi|134093271|ref|YP_001109572.1| hypothetical protein Poptr_cp095 [Populus trichocarpa] gi|133712108|gb|ABO36751.1| conserved hypothetical protein [Populus trichocarpa] gi|133712133|gb|ABO36776.1| conserved hypothetical protein [Populus trichocarpa] Length = 61 Score = 65.5 bits (158), Expect(2) = 2e-11 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 4 WSISIDRSCHIGPSRTSNCFDLNYPEDTLYI 96 WSISIDRSCHIGPS+TSNCFDLNYPED L I Sbjct: 10 WSISIDRSCHIGPSQTSNCFDLNYPEDALSI 40 Score = 30.0 bits (66), Expect(2) = 2e-11 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = +2 Query: 98 QKDVQSNLFLDSIEAQR 148 QK+ QSNLFLDSIEA+R Sbjct: 43 QKNGQSNLFLDSIEAKR 59