BLASTX nr result
ID: Cinnamomum23_contig00027309
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00027309 (770 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005863394.1| PREDICTED: soluble scavenger receptor cystei... 51 1e-05 >ref|XP_005863394.1| PREDICTED: soluble scavenger receptor cysteine-rich domain-containing protein SSC5D, partial [Myotis brandtii] Length = 805 Score = 50.8 bits (120), Expect(2) = 1e-05 Identities = 45/158 (28%), Positives = 56/158 (35%), Gaps = 9/158 (5%) Frame = +1 Query: 169 LPGLLFHRLPSPSSIKTQPLSPHCRTQNPHSTNFPTISKSPNPLHCNS*AQRP----TPH 336 +P RLP P H T PH P + +P P A P TPH Sbjct: 485 VPSPEMRRLPGPGE-------EHDPTTTPHPITIPHPTTTPQPATAAHPATTPFPSTTPH 537 Query: 337 LPLTHHQNQEPLPTSRALAYSISIETTIPSHKDPIHPQSTFTVTRNPSLLKPPNS-PFHT 513 LP T H P S +I T P HP T T +P+L P S P T Sbjct: 538 LPTTSHPTTTSQPISTPNPITIPYPVTAPHPTTTPHP----TTTTHPALAPGPTSAPVVT 593 Query: 514 IRNL----RYQNPFPNNHIIPNTQLHPNPTISVESHPN 615 ++L + P P + LHP T HP+ Sbjct: 594 TKSLLTSSETELPSPTPALTAKPSLHPQWTFMGAPHPS 631 Score = 26.2 bits (56), Expect(2) = 1e-05 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 615 PNPISQSTVTPHPHPNNQSENPSIPTPNP 701 P+P S++ P P P + NPS P+P P Sbjct: 630 PSPSHVSSLEPSPDPES---NPSSPSPAP 655