BLASTX nr result
ID: Cinnamomum23_contig00027286
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00027286 (456 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010248778.1| PREDICTED: zinc finger CCCH domain-containin... 67 6e-09 ref|XP_010248777.1| PREDICTED: zinc finger CCCH domain-containin... 67 6e-09 ref|XP_004501830.1| PREDICTED: zinc finger CCCH domain-containin... 65 2e-08 ref|XP_003638527.1| Zinc finger CCCH domain-containing protein [... 63 7e-08 gb|KHN34381.1| Zinc finger CCCH domain-containing protein 43 [Gl... 62 1e-07 gb|KHN14074.1| Zinc finger CCCH domain-containing protein 43 [Gl... 62 1e-07 ref|XP_003549835.1| PREDICTED: zinc finger CCCH domain-containin... 62 1e-07 ref|XP_003525622.1| PREDICTED: zinc finger CCCH domain-containin... 62 1e-07 ref|XP_007155512.1| hypothetical protein PHAVU_003G207900g [Phas... 62 2e-07 ref|XP_002511264.1| nucleic acid binding protein, putative [Rici... 60 4e-07 ref|XP_002277300.1| PREDICTED: zinc finger CCCH domain-containin... 60 6e-07 ref|XP_007037859.1| Zinc finger C-x8-C-x5-C-x3-H type family pro... 60 6e-07 ref|XP_007209937.1| hypothetical protein PRUPE_ppa004690mg [Prun... 60 6e-07 ref|XP_010519530.1| PREDICTED: zinc finger CCCH domain-containin... 59 1e-06 ref|XP_008239614.1| PREDICTED: zinc finger CCCH domain-containin... 59 1e-06 ref|XP_012438979.1| PREDICTED: zinc finger CCCH domain-containin... 59 1e-06 gb|KJB51161.1| hypothetical protein B456_008G204400, partial [Go... 59 1e-06 ref|XP_012438978.1| PREDICTED: zinc finger CCCH domain-containin... 59 1e-06 gb|KHG04838.1| hypothetical protein F383_29515 [Gossypium arboreum] 59 1e-06 ref|XP_004515843.1| PREDICTED: zinc finger CCCH domain-containin... 59 1e-06 >ref|XP_010248778.1| PREDICTED: zinc finger CCCH domain-containing protein 67 isoform X2 [Nelumbo nucifera] Length = 447 Score = 66.6 bits (161), Expect = 6e-09 Identities = 27/50 (54%), Positives = 33/50 (66%) Frame = -1 Query: 456 DQTTCVHYSRYGICKFGPACKHDHPINSGPLATPVTPASDRTPSLDKSTS 307 DQ+ C HY+RYGICKFGPACK DHPIN P + + + PS S+S Sbjct: 382 DQSICTHYNRYGICKFGPACKFDHPINCAPSTSSIVSTPSQPPSFGVSSS 431 >ref|XP_010248777.1| PREDICTED: zinc finger CCCH domain-containing protein 67 isoform X1 [Nelumbo nucifera] Length = 450 Score = 66.6 bits (161), Expect = 6e-09 Identities = 27/50 (54%), Positives = 33/50 (66%) Frame = -1 Query: 456 DQTTCVHYSRYGICKFGPACKHDHPINSGPLATPVTPASDRTPSLDKSTS 307 DQ+ C HY+RYGICKFGPACK DHPIN P + + + PS S+S Sbjct: 385 DQSICTHYNRYGICKFGPACKFDHPINCAPSTSSIVSTPSQPPSFGVSSS 434 >ref|XP_004501830.1| PREDICTED: zinc finger CCCH domain-containing protein 67-like [Cicer arietinum] Length = 472 Score = 65.1 bits (157), Expect = 2e-08 Identities = 33/56 (58%), Positives = 34/56 (60%), Gaps = 2/56 (3%) Frame = -1 Query: 456 DQTTCVHYSRYGICKFGPACKHDHPINSGPLATPVTPASDRTPSLDKSTS--EEAG 295 DQ C HYSRYGICKFGPACK DHPIN P P D+ S S S EEAG Sbjct: 408 DQNVCTHYSRYGICKFGPACKFDHPINPPP-PPPTMRGHDQQSSYTNSASIEEEAG 462 >ref|XP_003638527.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|657394322|gb|KEH34987.1| zinc finger CCCH domain protein [Medicago truncatula] Length = 511 Score = 63.2 bits (152), Expect = 7e-08 Identities = 32/54 (59%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Frame = -1 Query: 453 QTTCVHYSRYGICKFGPACKHDHPINSGPLATPVTPASDRTPSLDKSTS-EEAG 295 Q C HYSRYGICKFGPACK+DHPIN P P P + S S S EEAG Sbjct: 452 QNVCTHYSRYGICKFGPACKYDHPINLPP---PTMPGRYQQSSHTNSASIEEAG 502 >gb|KHN34381.1| Zinc finger CCCH domain-containing protein 43 [Glycine soja] Length = 490 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -1 Query: 456 DQTTCVHYSRYGICKFGPACKHDHPINSGPLATP 355 DQ+ C HYSRYGICKFGPACK DHPIN P+ P Sbjct: 424 DQSVCSHYSRYGICKFGPACKFDHPINLQPVMIP 457 >gb|KHN14074.1| Zinc finger CCCH domain-containing protein 43 [Glycine soja] Length = 501 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -1 Query: 456 DQTTCVHYSRYGICKFGPACKHDHPINSGPLATP 355 DQ+ C HYSRYGICKFGPACK DHPIN P+ P Sbjct: 434 DQSVCSHYSRYGICKFGPACKFDHPINLQPVMIP 467 >ref|XP_003549835.1| PREDICTED: zinc finger CCCH domain-containing protein 43-like [Glycine max] Length = 501 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -1 Query: 456 DQTTCVHYSRYGICKFGPACKHDHPINSGPLATP 355 DQ+ C HYSRYGICKFGPACK DHPIN P+ P Sbjct: 434 DQSVCSHYSRYGICKFGPACKFDHPINLQPVMIP 467 >ref|XP_003525622.1| PREDICTED: zinc finger CCCH domain-containing protein 43-like [Glycine max] Length = 490 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -1 Query: 456 DQTTCVHYSRYGICKFGPACKHDHPINSGPLATP 355 DQ+ C HYSRYGICKFGPACK DHPIN P+ P Sbjct: 424 DQSVCSHYSRYGICKFGPACKFDHPINLQPVMIP 457 >ref|XP_007155512.1| hypothetical protein PHAVU_003G207900g [Phaseolus vulgaris] gi|561028866|gb|ESW27506.1| hypothetical protein PHAVU_003G207900g [Phaseolus vulgaris] Length = 485 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -1 Query: 456 DQTTCVHYSRYGICKFGPACKHDHPINSGPL 364 DQ+ C HYSRYGICKFGPACK DHPIN PL Sbjct: 419 DQSVCSHYSRYGICKFGPACKFDHPINLQPL 449 >ref|XP_002511264.1| nucleic acid binding protein, putative [Ricinus communis] gi|223550379|gb|EEF51866.1| nucleic acid binding protein, putative [Ricinus communis] Length = 495 Score = 60.5 bits (145), Expect = 4e-07 Identities = 32/66 (48%), Positives = 38/66 (57%), Gaps = 1/66 (1%) Frame = -1 Query: 453 QTTCVHYSRYGICKFGPACKHDHPINSGPLATPVTPASD-RTPSLDKSTSEEAGVLTC*N 277 Q C +YSRYGICKFGPACK DHPI P+++ A D R P D T EEA + N Sbjct: 428 QNICSYYSRYGICKFGPACKFDHPIQ--PVSSTTGSADDVRMPFSDSGTKEEAKMALSGN 485 Query: 276 VVKVQI 259 + I Sbjct: 486 ASDIAI 491 >ref|XP_002277300.1| PREDICTED: zinc finger CCCH domain-containing protein 67 [Vitis vinifera] gi|297733636|emb|CBI14883.3| unnamed protein product [Vitis vinifera] Length = 484 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/54 (50%), Positives = 34/54 (62%), Gaps = 2/54 (3%) Frame = -1 Query: 456 DQTTCVHYSRYGICKFGPACKHDHPINSGPLATPVTPAS--DRTPSLDKSTSEE 301 DQ C HY+RYGICKFGPACK DHP+N G A+ + S D+ P S + + Sbjct: 413 DQNICTHYNRYGICKFGPACKFDHPVNYGNSASAPSAESGQDQPPPFGGSVTAD 466 >ref|XP_007037859.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative [Theobroma cacao] gi|508775104|gb|EOY22360.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative [Theobroma cacao] Length = 495 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/55 (47%), Positives = 36/55 (65%) Frame = -1 Query: 456 DQTTCVHYSRYGICKFGPACKHDHPINSGPLATPVTPASDRTPSLDKSTSEEAGV 292 DQ+ C HYSRYGICKFGPACK DH + + P + V+ P + + +EE+G+ Sbjct: 429 DQSICSHYSRYGICKFGPACKFDHSVQAAP--SVVSGLDQPLPFSNSAATEESGI 481 >ref|XP_007209937.1| hypothetical protein PRUPE_ppa004690mg [Prunus persica] gi|462405672|gb|EMJ11136.1| hypothetical protein PRUPE_ppa004690mg [Prunus persica] Length = 496 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = -1 Query: 456 DQTTCVHYSRYGICKFGPACKHDHPINSGPLATPVTPASD-RTPSLDKSTSEEAG 295 DQ C HYSRYGICKFGP CK DHP+N + + T D + P D +T+ AG Sbjct: 428 DQNICTHYSRYGICKFGPVCKFDHPLN---ITSSTTSGPDHQLPFSDSATTNGAG 479 >ref|XP_010519530.1| PREDICTED: zinc finger CCCH domain-containing protein 43-like [Tarenaya hassleriana] Length = 430 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/54 (48%), Positives = 34/54 (62%) Frame = -1 Query: 456 DQTTCVHYSRYGICKFGPACKHDHPINSGPLATPVTPASDRTPSLDKSTSEEAG 295 DQ+ C HYSRYGICKFGPACK DH + P + +P + P +D + +E G Sbjct: 377 DQSLCAHYSRYGICKFGPACKFDHSVQ--PPCSTGSPQAMEAPQVDANGNESDG 428 >ref|XP_008239614.1| PREDICTED: zinc finger CCCH domain-containing protein 67-like [Prunus mume] Length = 462 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/55 (50%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = -1 Query: 456 DQTTCVHYSRYGICKFGPACKHDHPINSGPLATPVTPASD-RTPSLDKSTSEEAG 295 DQ C HYSRYGICKFGP CK DHP+N + + T D + P D +T AG Sbjct: 394 DQNICTHYSRYGICKFGPVCKFDHPLN---ITSSTTSGPDHQLPFSDSATMNGAG 445 >ref|XP_012438979.1| PREDICTED: zinc finger CCCH domain-containing protein 43 isoform X2 [Gossypium raimondii] Length = 242 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/55 (45%), Positives = 30/55 (54%) Frame = -1 Query: 456 DQTTCVHYSRYGICKFGPACKHDHPINSGPLATPVTPASDRTPSLDKSTSEEAGV 292 DQT C HYSRYGICKFGPACK DH P + P + +E+ G+ Sbjct: 176 DQTICSHYSRYGICKFGPACKFDHSKQEAPSTMAMAGLDQPPPFSHSAATEQTGI 230 >gb|KJB51161.1| hypothetical protein B456_008G204400, partial [Gossypium raimondii] Length = 376 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/55 (45%), Positives = 30/55 (54%) Frame = -1 Query: 456 DQTTCVHYSRYGICKFGPACKHDHPINSGPLATPVTPASDRTPSLDKSTSEEAGV 292 DQT C HYSRYGICKFGPACK DH P + P + +E+ G+ Sbjct: 310 DQTICSHYSRYGICKFGPACKFDHSKQEAPSTMAMAGLDQPPPFSHSAATEQTGI 364 >ref|XP_012438978.1| PREDICTED: zinc finger CCCH domain-containing protein 43 isoform X1 [Gossypium raimondii] gi|763784089|gb|KJB51160.1| hypothetical protein B456_008G204400 [Gossypium raimondii] Length = 456 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/55 (45%), Positives = 30/55 (54%) Frame = -1 Query: 456 DQTTCVHYSRYGICKFGPACKHDHPINSGPLATPVTPASDRTPSLDKSTSEEAGV 292 DQT C HYSRYGICKFGPACK DH P + P + +E+ G+ Sbjct: 390 DQTICSHYSRYGICKFGPACKFDHSKQEAPSTMAMAGLDQPPPFSHSAATEQTGI 444 >gb|KHG04838.1| hypothetical protein F383_29515 [Gossypium arboreum] Length = 468 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/55 (45%), Positives = 30/55 (54%) Frame = -1 Query: 456 DQTTCVHYSRYGICKFGPACKHDHPINSGPLATPVTPASDRTPSLDKSTSEEAGV 292 DQT C HYSRYGICKFGPACK DH P + P + +E+ G+ Sbjct: 402 DQTICSHYSRYGICKFGPACKFDHSKQEAPSTMAMAGLDQPPPFSHSAATEQTGI 456 >ref|XP_004515843.1| PREDICTED: zinc finger CCCH domain-containing protein 43-like [Cicer arietinum] Length = 504 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 456 DQTTCVHYSRYGICKFGPACKHDHPINSGPL 364 DQ+ C HYSRYGICKFGPAC+ DHP NS PL Sbjct: 439 DQSICSHYSRYGICKFGPACRFDHPENSLPL 469