BLASTX nr result
ID: Cinnamomum23_contig00026746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00026746 (415 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012853074.1| PREDICTED: putative disease resistance prote... 65 2e-08 gb|EYU24301.1| hypothetical protein MIMGU_mgv1a020013mg [Erythra... 65 2e-08 ref|XP_012854306.1| PREDICTED: putative disease resistance prote... 60 7e-07 ref|XP_012853911.1| PREDICTED: putative disease resistance prote... 60 7e-07 gb|EYU23273.1| hypothetical protein MIMGU_mgv1a000607mg [Erythra... 60 7e-07 ref|XP_012853073.1| PREDICTED: putative disease resistance prote... 58 2e-06 ref|XP_012854089.1| PREDICTED: putative disease resistance prote... 57 4e-06 ref|XP_010279598.1| PREDICTED: disease resistance protein RGA2-l... 57 4e-06 gb|EYU24298.1| hypothetical protein MIMGU_mgv1a0242342mg, partia... 57 4e-06 gb|EYU23272.1| hypothetical protein MIMGU_mgv1a024450mg [Erythra... 57 4e-06 ref|XP_011000587.1| PREDICTED: putative disease resistance RPP13... 57 5e-06 ref|XP_010918018.1| PREDICTED: disease resistance protein RGA2-l... 57 5e-06 ref|XP_012851496.1| PREDICTED: putative disease resistance prote... 57 6e-06 gb|EYU28986.1| hypothetical protein MIMGU_mgv1a0225242mg, partia... 57 6e-06 gb|EYU25610.1| hypothetical protein MIMGU_mgv1a019163mg [Erythra... 57 6e-06 ref|XP_002297736.2| hypothetical protein POPTR_0001s06650g [Popu... 57 6e-06 ref|XP_012854175.1| PREDICTED: putative disease resistance prote... 56 8e-06 gb|EYU23338.1| hypothetical protein MIMGU_mgv1a019519mg [Erythra... 56 8e-06 gb|EYU23291.1| hypothetical protein MIMGU_mgv1a018877mg [Erythra... 56 8e-06 >ref|XP_012853074.1| PREDICTED: putative disease resistance protein RGA4 [Erythranthe guttatus] Length = 554 Score = 64.7 bits (156), Expect = 2e-08 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +2 Query: 2 IRECPHLERRCQKEKGEDWHKIAHIPSITIGSW 100 ++ECP LERRC++EKGEDWHKIAHIP + IG W Sbjct: 520 VQECPELERRCEREKGEDWHKIAHIPHLQIGEW 552 >gb|EYU24301.1| hypothetical protein MIMGU_mgv1a020013mg [Erythranthe guttata] Length = 433 Score = 64.7 bits (156), Expect = 2e-08 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +2 Query: 2 IRECPHLERRCQKEKGEDWHKIAHIPSITIGSW 100 ++ECP LERRC++EKGEDWHKIAHIP + IG W Sbjct: 399 VQECPELERRCEREKGEDWHKIAHIPHLQIGEW 431 >ref|XP_012854306.1| PREDICTED: putative disease resistance protein RGA4 [Erythranthe guttatus] Length = 1076 Score = 59.7 bits (143), Expect = 7e-07 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +2 Query: 2 IRECPHLERRCQKEKGEDWHKIAHIPSITIG 94 ++ECP +ERRC++EKGEDWHKIAHIP + IG Sbjct: 1046 VQECPEMERRCEREKGEDWHKIAHIPHLKIG 1076 >ref|XP_012853911.1| PREDICTED: putative disease resistance protein RGA4 [Erythranthe guttatus] Length = 267 Score = 59.7 bits (143), Expect = 7e-07 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +2 Query: 2 IRECPHLERRCQKEKGEDWHKIAHIPSITIGSW 100 + +CP LERRC++ KGEDWHKIAHIP + IG W Sbjct: 233 VDKCPELERRCERGKGEDWHKIAHIPRLNIGKW 265 >gb|EYU23273.1| hypothetical protein MIMGU_mgv1a000607mg [Erythranthe guttata] Length = 1046 Score = 59.7 bits (143), Expect = 7e-07 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +2 Query: 2 IRECPHLERRCQKEKGEDWHKIAHIPSITIG 94 ++ECP +ERRC++EKGEDWHKIAHIP + IG Sbjct: 1016 VQECPEMERRCEREKGEDWHKIAHIPHLKIG 1046 >ref|XP_012853073.1| PREDICTED: putative disease resistance protein RGA4 [Erythranthe guttatus] Length = 1075 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = +2 Query: 2 IRECPHLERRCQKEKGEDWHKIAHIPSITIG 94 +R CP +ERRC++EKGEDWHKIAHIP + IG Sbjct: 1045 VRGCPEMERRCEREKGEDWHKIAHIPHLYIG 1075 >ref|XP_012854089.1| PREDICTED: putative disease resistance protein RGA4 [Erythranthe guttatus] Length = 598 Score = 57.4 bits (137), Expect = 4e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +2 Query: 2 IRECPHLERRCQKEKGEDWHKIAHIPSITIGSW 100 ++E P LERRC++EKGEDWHKIAHI + IG W Sbjct: 564 VQEFPELERRCEREKGEDWHKIAHIAHLQIGEW 596 >ref|XP_010279598.1| PREDICTED: disease resistance protein RGA2-like [Nelumbo nucifera] Length = 1076 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +2 Query: 2 IRECPHLERRCQKEKGEDWHKIAHIPSITI 91 IR+CP LERRC K++GEDWHKIAHIP I I Sbjct: 1044 IRKCPQLERRCSKDRGEDWHKIAHIPHIQI 1073 >gb|EYU24298.1| hypothetical protein MIMGU_mgv1a0242342mg, partial [Erythranthe guttata] Length = 348 Score = 57.4 bits (137), Expect = 4e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +2 Query: 2 IRECPHLERRCQKEKGEDWHKIAHIPSITIGSW 100 ++E P LERRC++EKGEDWHKIAHI + IG W Sbjct: 314 VQEFPELERRCEREKGEDWHKIAHIAHLQIGEW 346 >gb|EYU23272.1| hypothetical protein MIMGU_mgv1a024450mg [Erythranthe guttata] Length = 854 Score = 57.4 bits (137), Expect = 4e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +2 Query: 2 IRECPHLERRCQKEKGEDWHKIAHIPSITIGSW 100 ++E P LERRC++EKGEDWHKIAHI + IG W Sbjct: 820 VQEFPELERRCEREKGEDWHKIAHIAHLQIGEW 852 >ref|XP_011000587.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Populus euphratica] gi|743913362|ref|XP_011000588.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Populus euphratica] gi|743913364|ref|XP_011000589.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Populus euphratica] gi|743913366|ref|XP_011000590.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Populus euphratica] gi|743913368|ref|XP_011000591.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Populus euphratica] gi|743913370|ref|XP_011000592.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Populus euphratica] gi|743913372|ref|XP_011000593.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Populus euphratica] gi|743913374|ref|XP_011000594.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Populus euphratica] gi|743913376|ref|XP_011000595.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Populus euphratica] gi|743913378|ref|XP_011000596.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Populus euphratica] gi|743913380|ref|XP_011000597.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Populus euphratica] Length = 1255 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +2 Query: 2 IRECPHLERRCQKEKGEDWHKIAHIPSITIGS 97 IRECP LE RCQ+EKGEDWHKI H+P+I I S Sbjct: 1222 IRECPLLESRCQREKGEDWHKIQHVPNIHIYS 1253 >ref|XP_010918018.1| PREDICTED: disease resistance protein RGA2-like [Elaeis guineensis] Length = 1129 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +2 Query: 2 IRECPHLERRCQKEKGEDWHKIAHIPSITIGS 97 I CP L RRC++EKGEDWHKIAHIPSI I S Sbjct: 1096 ISNCPQLVRRCEREKGEDWHKIAHIPSINIWS 1127 >ref|XP_012851496.1| PREDICTED: putative disease resistance protein RGA4 [Erythranthe guttatus] Length = 1095 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +2 Query: 2 IRECPHLERRCQKEKGEDWHKIAHIPSITIG 94 I++CP LE RCQ+EKGEDWHKIAHIP IG Sbjct: 1061 IKKCPELEMRCQREKGEDWHKIAHIPHPEIG 1091 >gb|EYU28986.1| hypothetical protein MIMGU_mgv1a0225242mg, partial [Erythranthe guttata] Length = 47 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +2 Query: 2 IRECPHLERRCQKEKGEDWHKIAHIPSITIG 94 I++CP LE RCQ+EKGEDWHKIAHIP IG Sbjct: 13 IKKCPELEMRCQREKGEDWHKIAHIPHPEIG 43 >gb|EYU25610.1| hypothetical protein MIMGU_mgv1a019163mg [Erythranthe guttata] Length = 1083 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +2 Query: 2 IRECPHLERRCQKEKGEDWHKIAHIPSITIG 94 I++CP LE RCQ+EKGEDWHKIAHIP IG Sbjct: 1049 IKKCPELEMRCQREKGEDWHKIAHIPHPEIG 1079 >ref|XP_002297736.2| hypothetical protein POPTR_0001s06650g [Populus trichocarpa] gi|105922499|gb|ABF81420.1| NBS type disease resistance protein [Populus trichocarpa] gi|550346679|gb|EEE82541.2| hypothetical protein POPTR_0001s06650g [Populus trichocarpa] Length = 1234 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +2 Query: 2 IRECPHLERRCQKEKGEDWHKIAHIPSITI 91 IRECP LE RCQ+EKGEDWHKI H+P+I I Sbjct: 1201 IRECPLLESRCQREKGEDWHKIQHVPNIHI 1230 >ref|XP_012854175.1| PREDICTED: putative disease resistance protein RGA3 [Erythranthe guttatus] Length = 1073 Score = 56.2 bits (134), Expect = 8e-06 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = +2 Query: 2 IRECPHLERRCQKEKGEDWHKIAHIPSITIG 94 +RECP LERRC++E G DWHKI+HIP + IG Sbjct: 1041 VRECPELERRCERETGADWHKISHIPHLQIG 1071 >gb|EYU23338.1| hypothetical protein MIMGU_mgv1a019519mg [Erythranthe guttata] Length = 916 Score = 56.2 bits (134), Expect = 8e-06 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = +2 Query: 2 IRECPHLERRCQKEKGEDWHKIAHIPSITIG 94 +RECP LERRC++E G DWHKI+HIP + IG Sbjct: 884 VRECPELERRCERETGADWHKISHIPHLQIG 914 >gb|EYU23291.1| hypothetical protein MIMGU_mgv1a018877mg [Erythranthe guttata] Length = 1032 Score = 56.2 bits (134), Expect = 8e-06 Identities = 21/29 (72%), Positives = 26/29 (89%) Frame = +2 Query: 11 CPHLERRCQKEKGEDWHKIAHIPSITIGS 97 CP LERRC++EKGEDWHKI+HIP + IG+ Sbjct: 972 CPELERRCEREKGEDWHKISHIPHLQIGT 1000