BLASTX nr result
ID: Cinnamomum23_contig00026695
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00026695 (292 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003607843.1| Vesicle-associated membrane protein [Medicag... 156 6e-36 gb|AFK40215.1| unknown [Medicago truncatula] 156 6e-36 ref|XP_004505324.1| PREDICTED: vesicle-associated membrane prote... 155 7e-36 ref|XP_007157801.1| hypothetical protein PHAVU_002G099400g [Phas... 154 2e-35 gb|ACJ84389.1| unknown [Medicago truncatula] 154 2e-35 gb|KHN08022.1| Putative vesicle-associated membrane protein 726 ... 152 8e-35 ref|XP_006583934.1| PREDICTED: vesicle-associated membrane prote... 152 8e-35 ref|XP_010242074.1| PREDICTED: vesicle-associated membrane prote... 151 2e-34 ref|XP_012082169.1| PREDICTED: vesicle-associated membrane prote... 151 2e-34 ref|XP_004233223.1| PREDICTED: vesicle-associated membrane prote... 150 2e-34 ref|XP_011096786.1| PREDICTED: vesicle-associated membrane prote... 150 3e-34 ref|XP_009604671.1| PREDICTED: vesicle-associated membrane prote... 150 3e-34 ref|XP_007147528.1| hypothetical protein PHAVU_006G132100g [Phas... 150 3e-34 ref|XP_009802587.1| PREDICTED: vesicle-associated membrane prote... 150 4e-34 ref|XP_009618936.1| PREDICTED: vesicle-associated membrane prote... 150 4e-34 ref|XP_008459063.1| PREDICTED: vesicle-associated membrane prote... 150 4e-34 ref|XP_002530145.1| Vesicle-associated membrane protein, putativ... 150 4e-34 ref|XP_003594451.1| Vesicle-associated membrane protein [Medicag... 150 4e-34 ref|XP_008225792.1| PREDICTED: vesicle-associated membrane prote... 149 5e-34 ref|XP_007212008.1| hypothetical protein PRUPE_ppa011167mg [Prun... 149 5e-34 >ref|XP_003607843.1| Vesicle-associated membrane protein [Medicago truncatula] gi|217070986|gb|ACJ83853.1| unknown [Medicago truncatula] gi|355508898|gb|AES90040.1| synaptobrevin-like protein [Medicago truncatula] Length = 220 Score = 156 bits (394), Expect = 6e-36 Identities = 75/78 (96%), Positives = 78/78 (100%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 MQYCVDHPEE+SKLAKVKAQVSEVKGVMMENI+KVLDRGEKIE+LVDKTENLHHQAQDFR Sbjct: 120 MQYCVDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFR 179 Query: 112 NSGTKIRRKMWLQNMKIK 59 NSGTKIRRKMWLQNMKIK Sbjct: 180 NSGTKIRRKMWLQNMKIK 197 >gb|AFK40215.1| unknown [Medicago truncatula] Length = 220 Score = 156 bits (394), Expect = 6e-36 Identities = 75/78 (96%), Positives = 78/78 (100%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 MQYCVDHPEE+SKLAKVKAQVSEVKGVMMENI+KVLDRGEKIE+LVDKTENLHHQAQDFR Sbjct: 120 MQYCVDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFR 179 Query: 112 NSGTKIRRKMWLQNMKIK 59 NSGTKIRRKMWLQNMKIK Sbjct: 180 NSGTKIRRKMWLQNMKIK 197 >ref|XP_004505324.1| PREDICTED: vesicle-associated membrane protein 721-like [Cicer arietinum] Length = 222 Score = 155 bits (393), Expect = 7e-36 Identities = 75/78 (96%), Positives = 78/78 (100%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENI+KVLDRGEKIE+LVDKTENLHHQAQDFR Sbjct: 122 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFR 181 Query: 112 NSGTKIRRKMWLQNMKIK 59 NSGTKIRRKMW+QNMKIK Sbjct: 182 NSGTKIRRKMWMQNMKIK 199 >ref|XP_007157801.1| hypothetical protein PHAVU_002G099400g [Phaseolus vulgaris] gi|561031216|gb|ESW29795.1| hypothetical protein PHAVU_002G099400g [Phaseolus vulgaris] Length = 226 Score = 154 bits (390), Expect = 2e-35 Identities = 74/78 (94%), Positives = 78/78 (100%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 MQYCV+HPEEISKLAKVKAQVSEVKGVMMENI+KVLDRGEKIE+LVDKTENLHHQAQDFR Sbjct: 122 MQYCVEHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFR 181 Query: 112 NSGTKIRRKMWLQNMKIK 59 NSGTKIRRKMWLQNMK+K Sbjct: 182 NSGTKIRRKMWLQNMKVK 199 >gb|ACJ84389.1| unknown [Medicago truncatula] Length = 197 Score = 154 bits (389), Expect = 2e-35 Identities = 74/77 (96%), Positives = 77/77 (100%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 MQYCVDHPEE+SKLAKVKAQVSEVKGVMMENI+KVLDRGEKIE+LVDKTENLHHQAQDFR Sbjct: 120 MQYCVDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFR 179 Query: 112 NSGTKIRRKMWLQNMKI 62 NSGTKIRRKMWLQNMKI Sbjct: 180 NSGTKIRRKMWLQNMKI 196 >gb|KHN08022.1| Putative vesicle-associated membrane protein 726 [Glycine soja] Length = 225 Score = 152 bits (384), Expect = 8e-35 Identities = 74/78 (94%), Positives = 77/78 (98%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 MQYCV+HPEEISKLAKVKAQVSEVK VMMENI+KVLDRGEKIE+LVDKTENLHHQAQDFR Sbjct: 122 MQYCVEHPEEISKLAKVKAQVSEVKDVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFR 181 Query: 112 NSGTKIRRKMWLQNMKIK 59 NSGTKIRRKMWLQNMKIK Sbjct: 182 NSGTKIRRKMWLQNMKIK 199 >ref|XP_006583934.1| PREDICTED: vesicle-associated membrane protein 722-like [Glycine max] gi|734425255|gb|KHN42974.1| Putative vesicle-associated membrane protein 726 [Glycine soja] Length = 225 Score = 152 bits (384), Expect = 8e-35 Identities = 74/78 (94%), Positives = 77/78 (98%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 MQYCV+HPEEISKLAKVKAQVSEVK VMMENI+KVLDRGEKIE+LVDKTENLHHQAQDFR Sbjct: 122 MQYCVEHPEEISKLAKVKAQVSEVKDVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFR 181 Query: 112 NSGTKIRRKMWLQNMKIK 59 NSGTKIRRKMWLQNMKIK Sbjct: 182 NSGTKIRRKMWLQNMKIK 199 >ref|XP_010242074.1| PREDICTED: vesicle-associated membrane protein 721-like [Nelumbo nucifera] Length = 222 Score = 151 bits (381), Expect = 2e-34 Identities = 72/78 (92%), Positives = 78/78 (100%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 MQYC+DHPEEISKLAKVKAQVSEVKGVMMENI+KVLDRGEKIE+LVDKTENLH+QAQDFR Sbjct: 119 MQYCIDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHNQAQDFR 178 Query: 112 NSGTKIRRKMWLQNMKIK 59 N+GTK+RRKMWLQNMKIK Sbjct: 179 NTGTKMRRKMWLQNMKIK 196 >ref|XP_012082169.1| PREDICTED: vesicle-associated membrane protein 722-like [Jatropha curcas] gi|643717929|gb|KDP29315.1| hypothetical protein JCGZ_19410 [Jatropha curcas] Length = 221 Score = 151 bits (381), Expect = 2e-34 Identities = 74/78 (94%), Positives = 76/78 (97%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENI+KVLDRGEKIE+LVDKTENLH QAQDFR Sbjct: 118 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFR 177 Query: 112 NSGTKIRRKMWLQNMKIK 59 SGTKIRRKMWLQNMKIK Sbjct: 178 TSGTKIRRKMWLQNMKIK 195 >ref|XP_004233223.1| PREDICTED: vesicle-associated membrane protein 722-like [Solanum lycopersicum] gi|565393898|ref|XP_006362607.1| PREDICTED: vesicle-associated membrane protein 722-like [Solanum tuberosum] Length = 222 Score = 150 bits (380), Expect = 2e-34 Identities = 72/78 (92%), Positives = 77/78 (98%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 MQYC +HPEEISKLAKVKAQVSEVKGVMMENI+KVLDRGEKIE+LVDKTENLHHQAQDFR Sbjct: 119 MQYCAEHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFR 178 Query: 112 NSGTKIRRKMWLQNMKIK 59 N+GT+IRRKMWLQNMKIK Sbjct: 179 NTGTQIRRKMWLQNMKIK 196 >ref|XP_011096786.1| PREDICTED: vesicle-associated membrane protein 721-like [Sesamum indicum] Length = 226 Score = 150 bits (379), Expect = 3e-34 Identities = 72/78 (92%), Positives = 77/78 (98%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 MQYC++HPEEISKLAKVKAQVSEVKGVMMENI+KVLDRGEKIE+LVDKTENLHHQAQDFR Sbjct: 123 MQYCIEHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFR 182 Query: 112 NSGTKIRRKMWLQNMKIK 59 +GTKIRRKMWLQNMKIK Sbjct: 183 ATGTKIRRKMWLQNMKIK 200 >ref|XP_009604671.1| PREDICTED: vesicle-associated membrane protein 722-like [Nicotiana tomentosiformis] gi|698525232|ref|XP_009759428.1| PREDICTED: vesicle-associated membrane protein 722-like [Nicotiana sylvestris] Length = 222 Score = 150 bits (379), Expect = 3e-34 Identities = 71/78 (91%), Positives = 77/78 (98%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 MQYC DHP+EISK+AKVKAQVSEVKGVMMENI+KVLDRGEKIE+LVDKTENLHHQAQDFR Sbjct: 119 MQYCADHPDEISKIAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFR 178 Query: 112 NSGTKIRRKMWLQNMKIK 59 N+GT+IRRKMWLQNMKIK Sbjct: 179 NTGTQIRRKMWLQNMKIK 196 >ref|XP_007147528.1| hypothetical protein PHAVU_006G132100g [Phaseolus vulgaris] gi|561020751|gb|ESW19522.1| hypothetical protein PHAVU_006G132100g [Phaseolus vulgaris] Length = 221 Score = 150 bits (379), Expect = 3e-34 Identities = 73/78 (93%), Positives = 77/78 (98%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENI+KVLDRGEKIE+LVDKTENLH+QAQDFR Sbjct: 118 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHNQAQDFR 177 Query: 112 NSGTKIRRKMWLQNMKIK 59 SGT+IRRKMWLQNMKIK Sbjct: 178 TSGTRIRRKMWLQNMKIK 195 >ref|XP_009802587.1| PREDICTED: vesicle-associated membrane protein 721-like [Nicotiana sylvestris] Length = 222 Score = 150 bits (378), Expect = 4e-34 Identities = 71/78 (91%), Positives = 76/78 (97%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 M YC DHPEEISKLAKVKAQVSEVKGVMMENI+KVLDRGEKIE+LVDKTENLHHQAQDFR Sbjct: 119 MHYCADHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFR 178 Query: 112 NSGTKIRRKMWLQNMKIK 59 N+GT+IRRKMWLQNMK+K Sbjct: 179 NTGTQIRRKMWLQNMKVK 196 >ref|XP_009618936.1| PREDICTED: vesicle-associated membrane protein 721-like [Nicotiana tomentosiformis] Length = 222 Score = 150 bits (378), Expect = 4e-34 Identities = 71/78 (91%), Positives = 76/78 (97%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 M YC DHPEEISKLAKVKAQVSEVKGVMMENI+KVLDRGEKIE+LVDKTENLHHQAQDFR Sbjct: 119 MHYCADHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFR 178 Query: 112 NSGTKIRRKMWLQNMKIK 59 N+GT+IRRKMWLQNMK+K Sbjct: 179 NTGTQIRRKMWLQNMKVK 196 >ref|XP_008459063.1| PREDICTED: vesicle-associated membrane protein 722-like [Cucumis melo] Length = 222 Score = 150 bits (378), Expect = 4e-34 Identities = 72/78 (92%), Positives = 77/78 (98%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 MQYCVDHPEE+SKLAKVKAQVSEVKGVMMENI+KVLDRGEKIE+LVDKTENLH+QAQDF+ Sbjct: 118 MQYCVDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHNQAQDFK 177 Query: 112 NSGTKIRRKMWLQNMKIK 59 SGTKIRRKMWLQNMKIK Sbjct: 178 TSGTKIRRKMWLQNMKIK 195 >ref|XP_002530145.1| Vesicle-associated membrane protein, putative [Ricinus communis] gi|223530344|gb|EEF32237.1| Vesicle-associated membrane protein, putative [Ricinus communis] Length = 221 Score = 150 bits (378), Expect = 4e-34 Identities = 73/78 (93%), Positives = 76/78 (97%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 MQYCVDHPEEISK AKVKAQVSEVKGVMMENI+KVLDRGEKIE+LVDKTENLH QAQDFR Sbjct: 118 MQYCVDHPEEISKFAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFR 177 Query: 112 NSGTKIRRKMWLQNMKIK 59 +SGTKIRRKMWLQNMKIK Sbjct: 178 SSGTKIRRKMWLQNMKIK 195 >ref|XP_003594451.1| Vesicle-associated membrane protein [Medicago truncatula] gi|355483499|gb|AES64702.1| synaptobrevin-like protein [Medicago truncatula] Length = 220 Score = 150 bits (378), Expect = 4e-34 Identities = 71/78 (91%), Positives = 77/78 (98%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 MQYCVDHP+EISKLAKVKAQVSEVKGVMMENI+KVLDRGEKIE+LVDKT+NLHHQAQDFR Sbjct: 122 MQYCVDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLHHQAQDFR 181 Query: 112 NSGTKIRRKMWLQNMKIK 59 +SGT IRRKMWLQNMK+K Sbjct: 182 SSGTSIRRKMWLQNMKVK 199 >ref|XP_008225792.1| PREDICTED: vesicle-associated membrane protein 721-like [Prunus mume] Length = 221 Score = 149 bits (377), Expect = 5e-34 Identities = 72/78 (92%), Positives = 76/78 (97%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENI+KVLDRGEKIE+LVDKTENLH QAQDFR Sbjct: 118 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFR 177 Query: 112 NSGTKIRRKMWLQNMKIK 59 N GTK+RRKMWLQNMK+K Sbjct: 178 NVGTKMRRKMWLQNMKVK 195 >ref|XP_007212008.1| hypothetical protein PRUPE_ppa011167mg [Prunus persica] gi|462407873|gb|EMJ13207.1| hypothetical protein PRUPE_ppa011167mg [Prunus persica] Length = 221 Score = 149 bits (377), Expect = 5e-34 Identities = 72/78 (92%), Positives = 76/78 (97%) Frame = -1 Query: 292 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIDKVLDRGEKIEVLVDKTENLHHQAQDFR 113 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENI+KVLDRGEKIE+LVDKTENLH QAQDFR Sbjct: 118 MQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFR 177 Query: 112 NSGTKIRRKMWLQNMKIK 59 N GTK+RRKMWLQNMK+K Sbjct: 178 NVGTKMRRKMWLQNMKVK 195