BLASTX nr result
ID: Cinnamomum23_contig00026249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00026249 (532 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN63734.1| hypothetical protein VITISV_037247 [Vitis vinifera] 42 4e-06 >emb|CAN63734.1| hypothetical protein VITISV_037247 [Vitis vinifera] Length = 460 Score = 42.0 bits (97), Expect(2) = 4e-06 Identities = 22/42 (52%), Positives = 28/42 (66%) Frame = +3 Query: 249 QRGLGICSIEKPNKALLGKWLWRVLGEPSNGLQRQILIRKYK 374 Q GLGI S+ NKALLGKW W+ E N L +Q++I KY+ Sbjct: 196 QGGLGIRSLVALNKALLGKWNWKFAIE-RNSLWKQVIIDKYR 236 Score = 35.0 bits (79), Expect(2) = 4e-06 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 379 VSARIRYRVPNSLQVRF*HDEWCRQRVLKRRFSNLFLLGTS 501 + +R R+ V N +V+F D WC + LK F NLF L + Sbjct: 249 IRSRSRFIVGNGRKVKFWKDLWCENQALKDAFPNLFRLAVN 289