BLASTX nr result
ID: Cinnamomum23_contig00025691
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00025691 (223 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010260891.1| PREDICTED: tyrosine-sulfated glycopeptide re... 56 8e-06 >ref|XP_010260891.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Nelumbo nucifera] Length = 154 Score = 56.2 bits (134), Expect = 8e-06 Identities = 30/64 (46%), Positives = 40/64 (62%), Gaps = 6/64 (9%) Frame = +2 Query: 2 SGRIPMGAHFDTL----SGDGSAYMGNTLLCGTSIQKRCVSDTDHIGSGN--EKVEQEED 163 SGRIP G HFDTL GDGS ++GN LLCG ++K C ++T IGSG + +E + Sbjct: 40 SGRIPTGMHFDTLKGDGDGDGSPFIGNALLCGAPLEKTC-NETGPIGSGGGVDDIEVGAE 98 Query: 164 ERDM 175 D+ Sbjct: 99 REDL 102