BLASTX nr result
ID: Cinnamomum23_contig00025628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00025628 (266 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011084811.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_009623481.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_009798485.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 ref|XP_010253060.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_002319343.2| hypothetical protein POPTR_0013s09430g, part... 58 3e-06 ref|XP_002520874.1| pentatricopeptide repeat-containing protein,... 57 6e-06 >ref|XP_011084811.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Sesamum indicum] Length = 775 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 264 CSWIEVRDKVDLFFSGDSSSPRTVEIHATLKSLRRIM 154 CSWIEV++KVD+FFSGDSSSPRTV+I+ TL SLR M Sbjct: 722 CSWIEVKNKVDVFFSGDSSSPRTVKIYETLDSLRNSM 758 >ref|XP_009623481.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Nicotiana tomentosiformis] Length = 852 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = -3 Query: 264 CSWIEVRDKVDLFFSGDSSSPRTVEIHATLKSLRRIM 154 CSWIEV++K+D+FFS DSSSPRT+EI+ TL+SLR IM Sbjct: 805 CSWIEVKNKLDVFFSSDSSSPRTIEIYETLQSLRIIM 841 >ref|XP_009798485.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Nicotiana sylvestris] Length = 852 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/37 (70%), Positives = 34/37 (91%) Frame = -3 Query: 264 CSWIEVRDKVDLFFSGDSSSPRTVEIHATLKSLRRIM 154 CSWIEV++K+D+FFS DSSSPR++EI+ TL+SLR IM Sbjct: 805 CSWIEVKNKLDVFFSSDSSSPRSIEIYETLQSLRSIM 841 >ref|XP_010253060.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Nelumbo nucifera] Length = 870 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 264 CSWIEVRDKVDLFFSGDSSSPRTVEIHATLKSLRRIM 154 CSWIEVR+ VD+FFSGDSSSPRTVE+ TL SL+R M Sbjct: 822 CSWIEVRNGVDVFFSGDSSSPRTVEVCETLWSLKRNM 858 >ref|XP_002319343.2| hypothetical protein POPTR_0013s09430g, partial [Populus trichocarpa] gi|550325356|gb|EEE95266.2| hypothetical protein POPTR_0013s09430g, partial [Populus trichocarpa] Length = 792 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 264 CSWIEVRDKVDLFFSGDSSSPRTVEIHATLKSLRRIM 154 CSWIEV + +D+FFSGDSSSPRT+EI+ L SLRR M Sbjct: 744 CSWIEVGNSIDVFFSGDSSSPRTIEIYDLLNSLRRNM 780 >ref|XP_002520874.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540005|gb|EEF41583.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 833 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 264 CSWIEVRDKVDLFFSGDSSSPRTVEIHATLKSLRRIM 154 CSWIEVR+KVD+F+SGD SSP T EI+ TL SL+R M Sbjct: 784 CSWIEVRNKVDVFYSGDCSSPITTEIYDTLSSLKRNM 820