BLASTX nr result
ID: Cinnamomum23_contig00025417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00025417 (543 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009779924.1| PREDICTED: disease resistance protein RPS2-l... 64 3e-08 ref|XP_009609124.1| PREDICTED: disease resistance protein At4g27... 64 5e-08 gb|KCW67955.1| hypothetical protein EUGRSUZ_F01653 [Eucalyptus g... 56 8e-06 >ref|XP_009779924.1| PREDICTED: disease resistance protein RPS2-like [Nicotiana sylvestris] gi|698453348|ref|XP_009779925.1| PREDICTED: disease resistance protein RPS2-like [Nicotiana sylvestris] Length = 1002 Score = 64.3 bits (155), Expect = 3e-08 Identities = 33/89 (37%), Positives = 51/89 (57%) Frame = -3 Query: 268 SELYHCDIRDCRNLEYLMAEEEPLLPDIKELFIYYNRKLLVLCKGIPSPDALKSLESLSV 89 S L HC I+ C +E+++ E P+++ L I +L +CKGIP L +L+ L+V Sbjct: 774 SHLKHCKIKYCDEMEWIITSEWGTFPELELLEIEGLSRLQNICKGIPPAGTLSTLKVLNV 833 Query: 88 RGCDKLKYLLPARLLKQLGCLKSITVKFC 2 CD L LLP L++QL L+ I ++ C Sbjct: 834 TACDNLTTLLPLELVQQLNNLEEIELRSC 862 >ref|XP_009609124.1| PREDICTED: disease resistance protein At4g27190-like [Nicotiana tomentosiformis] gi|697110514|ref|XP_009609125.1| PREDICTED: disease resistance protein At4g27190-like [Nicotiana tomentosiformis] Length = 1002 Score = 63.5 bits (153), Expect = 5e-08 Identities = 34/89 (38%), Positives = 50/89 (56%) Frame = -3 Query: 268 SELYHCDIRDCRNLEYLMAEEEPLLPDIKELFIYYNRKLLVLCKGIPSPDALKSLESLSV 89 S L HC I+ C +E+++ E PD++ L I +L +CKGIP L +L+ L+V Sbjct: 774 SHLKHCKIKYCDEMEWIITSEWGTFPDLELLEIEGLSRLQNICKGIPPAGTLSTLKVLNV 833 Query: 88 RGCDKLKYLLPARLLKQLGCLKSITVKFC 2 CD L LLP L+ QL L+ I ++ C Sbjct: 834 IACDNLTSLLPLELVWQLNNLEEIELRSC 862 >gb|KCW67955.1| hypothetical protein EUGRSUZ_F01653 [Eucalyptus grandis] Length = 962 Score = 56.2 bits (134), Expect = 8e-06 Identities = 32/86 (37%), Positives = 47/86 (54%), Gaps = 7/86 (8%) Frame = -3 Query: 238 CRNLEYLMAEEEPL-LPDIKELFIYYNRKLLVLCKGIPSP------DALKSLESLSVRGC 80 C+ LEYL LP ++E+ IYY +++ + I SP A SLE++S+ GC Sbjct: 740 CQKLEYLFGHGSKFYLPHLREIEIYYCEEMVGITAAITSPPPPHSPQAFPSLEAISIEGC 799 Query: 79 DKLKYLLPARLLKQLGCLKSITVKFC 2 DK++ +L + L LK I VKFC Sbjct: 800 DKIERVLESEWLPYFPNLKRIKVKFC 825