BLASTX nr result
ID: Cinnamomum23_contig00024973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00024973 (312 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009412306.1| PREDICTED: allene oxide synthase 2-like [Mus... 94 5e-17 gb|AJD25174.1| cytochrome P450 CYP74A1 [Salvia miltiorrhiza] 87 4e-15 ref|XP_009393009.1| PREDICTED: allene oxide synthase 2-like [Mus... 87 4e-15 ref|XP_010694121.1| PREDICTED: allene oxide synthase, chloroplas... 87 6e-15 gb|ABD15175.1| allene oxide synthase 2 [Solanum tuberosum] 86 7e-15 ref|XP_009365629.1| PREDICTED: allene oxide synthase, chloroplas... 85 2e-14 ref|XP_008364980.1| PREDICTED: allene oxide synthase, chloroplas... 85 2e-14 ref|XP_008377370.1| PREDICTED: allene oxide synthase, chloroplas... 85 2e-14 ref|XP_006340212.1| PREDICTED: allene oxide synthase, chloroplas... 85 2e-14 ref|XP_007160802.1| hypothetical protein PHAVU_001G017800g [Phas... 85 2e-14 gb|ABD15176.1| allene oxide synthase 2 [Solanum tuberosum] 85 2e-14 gb|ABD15174.1| allene oxide synthase 2 [Solanum tuberosum] 85 2e-14 gb|ABD15173.1| allene oxide synthase 2 [Solanum tuberosum] 85 2e-14 gb|ABD15172.1| allene oxide synthase 2 [Solanum tuberosum] 85 2e-14 emb|CAD29736.2| allene oxide synthase [Solanum tuberosum] 85 2e-14 ref|XP_004501049.1| PREDICTED: allene oxide synthase-like [Cicer... 84 3e-14 ref|XP_008220731.1| PREDICTED: allene oxide synthase [Prunus mume] 84 5e-14 ref|XP_007222520.1| hypothetical protein PRUPE_ppa004133mg [Prun... 84 5e-14 gb|ABS50433.1| allene oxidase synthase [Hyoscyamus niger] 84 5e-14 gb|AAN37417.1| allene oxide synthase [Solanum tuberosum] 84 5e-14 >ref|XP_009412306.1| PREDICTED: allene oxide synthase 2-like [Musa acuminata subsp. malaccensis] Length = 484 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/69 (65%), Positives = 51/69 (73%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTFXXXXXXXXXXXXXX 131 +KYV+WSNGPE ESPTV+NKQCPGKDFVVL+GRLL+VEFFLRYDTF Sbjct: 411 IKYVVWSNGPETESPTVSNKQCPGKDFVVLVGRLLVVEFFLRYDTFTADVGTVLLGSQVT 470 Query: 130 XXSMTKATA 104 S+TKA A Sbjct: 471 VTSLTKAAA 479 >gb|AJD25174.1| cytochrome P450 CYP74A1 [Salvia miltiorrhiza] Length = 519 Score = 87.0 bits (214), Expect = 4e-15 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTF 173 LK+VLWSNGPENESPT+ NKQC GKDFVVLI RLLLVEFFLRYD+F Sbjct: 451 LKHVLWSNGPENESPTLHNKQCAGKDFVVLISRLLLVEFFLRYDSF 496 >ref|XP_009393009.1| PREDICTED: allene oxide synthase 2-like [Musa acuminata subsp. malaccensis] Length = 484 Score = 87.0 bits (214), Expect = 4e-15 Identities = 37/46 (80%), Positives = 44/46 (95%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTF 173 +KYV+WSNGPE E+P+VANKQCPGK+ VVL+GRLL+VEFFLRYDTF Sbjct: 406 IKYVVWSNGPETETPSVANKQCPGKELVVLVGRLLVVEFFLRYDTF 451 >ref|XP_010694121.1| PREDICTED: allene oxide synthase, chloroplastic [Beta vulgaris subsp. vulgaris] gi|870845970|gb|KMS98604.1| hypothetical protein BVRB_3g070470 [Beta vulgaris subsp. vulgaris] Length = 514 Score = 86.7 bits (213), Expect = 6e-15 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTF 173 LKYV+WSNGPENESPTV NKQC GKDFVVL+ RLLLVE FLRYD+F Sbjct: 446 LKYVVWSNGPENESPTVKNKQCAGKDFVVLVSRLLLVELFLRYDSF 491 >gb|ABD15175.1| allene oxide synthase 2 [Solanum tuberosum] Length = 510 Score = 86.3 bits (212), Expect = 7e-15 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTF 173 LKYVLWSNGPE ESPTV NKQC GKDFVV++ RL +VEFFLRYDTF Sbjct: 444 LKYVLWSNGPETESPTVGNKQCAGKDFVVMVSRLFVVEFFLRYDTF 489 >ref|XP_009365629.1| PREDICTED: allene oxide synthase, chloroplastic-like [Pyrus x bretschneideri] Length = 536 Score = 85.1 bits (209), Expect = 2e-14 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTF 173 LK+VLWSNGPE ESPTV NKQC GKDFVVL+ RLL+VEFFLRYD+F Sbjct: 468 LKHVLWSNGPETESPTVGNKQCAGKDFVVLVSRLLVVEFFLRYDSF 513 >ref|XP_008364980.1| PREDICTED: allene oxide synthase, chloroplastic-like [Malus domestica] Length = 531 Score = 85.1 bits (209), Expect = 2e-14 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTF 173 LK+VLWSNGPE ESPTV NKQC GKDFVVL+ RLL+VEFFLRYD+F Sbjct: 463 LKHVLWSNGPETESPTVGNKQCAGKDFVVLVSRLLVVEFFLRYDSF 508 >ref|XP_008377370.1| PREDICTED: allene oxide synthase, chloroplastic-like [Malus domestica] Length = 531 Score = 85.1 bits (209), Expect = 2e-14 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTF 173 LK+VLWSNGPE ESPTV NKQC GKDFVVL+ RLL+VEFFLRYD+F Sbjct: 463 LKHVLWSNGPETESPTVGNKQCAGKDFVVLVSRLLVVEFFLRYDSF 508 >ref|XP_006340212.1| PREDICTED: allene oxide synthase, chloroplastic [Solanum tuberosum] Length = 510 Score = 84.7 bits (208), Expect = 2e-14 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTF 173 LKYVLWSNGPE ESPTV NKQC GKDFVV++ RL + EFFLRYDTF Sbjct: 444 LKYVLWSNGPETESPTVGNKQCAGKDFVVMVSRLFVTEFFLRYDTF 489 >ref|XP_007160802.1| hypothetical protein PHAVU_001G017800g [Phaseolus vulgaris] gi|561034266|gb|ESW32796.1| hypothetical protein PHAVU_001G017800g [Phaseolus vulgaris] Length = 518 Score = 84.7 bits (208), Expect = 2e-14 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTF 173 LK+VLWSNGPE ESPTV NKQC GKDFV L+ RLLLVEFFLRYD+F Sbjct: 450 LKHVLWSNGPETESPTVGNKQCAGKDFVTLVSRLLLVEFFLRYDSF 495 >gb|ABD15176.1| allene oxide synthase 2 [Solanum tuberosum] Length = 510 Score = 84.7 bits (208), Expect = 2e-14 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTF 173 LKYVLWSNGPE ESPTV NKQC GKDFVV++ RL + EFFLRYDTF Sbjct: 444 LKYVLWSNGPETESPTVGNKQCAGKDFVVMVSRLFVTEFFLRYDTF 489 >gb|ABD15174.1| allene oxide synthase 2 [Solanum tuberosum] Length = 509 Score = 84.7 bits (208), Expect = 2e-14 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTF 173 LKYVLWSNGPE ESPTV NKQC GKDFVV++ RL + EFFLRYDTF Sbjct: 443 LKYVLWSNGPETESPTVGNKQCAGKDFVVMVSRLFVTEFFLRYDTF 488 >gb|ABD15173.1| allene oxide synthase 2 [Solanum tuberosum] Length = 509 Score = 84.7 bits (208), Expect = 2e-14 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTF 173 LKYVLWSNGPE ESPTV NKQC GKDFVV++ RL + EFFLRYDTF Sbjct: 443 LKYVLWSNGPETESPTVGNKQCAGKDFVVMVSRLFVTEFFLRYDTF 488 >gb|ABD15172.1| allene oxide synthase 2 [Solanum tuberosum] Length = 510 Score = 84.7 bits (208), Expect = 2e-14 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTF 173 LKYVLWSNGPE ESPTV NKQC GKDFVV++ RL + EFFLRYDTF Sbjct: 444 LKYVLWSNGPETESPTVGNKQCAGKDFVVMVSRLFVTEFFLRYDTF 489 >emb|CAD29736.2| allene oxide synthase [Solanum tuberosum] Length = 509 Score = 84.7 bits (208), Expect = 2e-14 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTF 173 LKYVLWSNGPE ESPTV NKQC GKDFVV++ RL + EFFLRYDTF Sbjct: 443 LKYVLWSNGPETESPTVGNKQCAGKDFVVMVSRLFVTEFFLRYDTF 488 >ref|XP_004501049.1| PREDICTED: allene oxide synthase-like [Cicer arietinum] Length = 540 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTF 173 LK+VLWSNGPE E PTV+NKQC GKDFVVL RLL+VEFFLRYDTF Sbjct: 472 LKHVLWSNGPETEQPTVSNKQCAGKDFVVLFSRLLVVEFFLRYDTF 517 >ref|XP_008220731.1| PREDICTED: allene oxide synthase [Prunus mume] Length = 528 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTF 173 LK+VLWSNGPE ESPTV NKQC GKDFVVL RLL+VEFFLRYD+F Sbjct: 460 LKHVLWSNGPETESPTVGNKQCAGKDFVVLASRLLVVEFFLRYDSF 505 >ref|XP_007222520.1| hypothetical protein PRUPE_ppa004133mg [Prunus persica] gi|462419456|gb|EMJ23719.1| hypothetical protein PRUPE_ppa004133mg [Prunus persica] Length = 528 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTF 173 LK+VLWSNGPE ESPTV NKQC GKDFVVL RLL+VEFFLRYD+F Sbjct: 460 LKHVLWSNGPETESPTVGNKQCAGKDFVVLASRLLVVEFFLRYDSF 505 >gb|ABS50433.1| allene oxidase synthase [Hyoscyamus niger] Length = 494 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTF 173 LK+VLWSNGPE E+PTV NKQC GKDFVVL+ RLL+ EFFLRYDTF Sbjct: 428 LKHVLWSNGPETENPTVENKQCAGKDFVVLVSRLLVTEFFLRYDTF 473 >gb|AAN37417.1| allene oxide synthase [Solanum tuberosum] Length = 507 Score = 83.6 bits (205), Expect = 5e-14 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -3 Query: 310 LKYVLWSNGPENESPTVANKQCPGKDFVVLIGRLLLVEFFLRYDTF 173 LKYVLWSNGPE ESPTV NKQC G+DFVV++ RL + EFFLRYDTF Sbjct: 441 LKYVLWSNGPETESPTVGNKQCAGRDFVVMVSRLFVTEFFLRYDTF 486