BLASTX nr result
ID: Cinnamomum23_contig00024582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00024582 (279 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002963939.1| hypothetical protein SELMODRAFT_230263 [Sela... 70 4e-10 ref|XP_002967980.1| hypothetical protein SELMODRAFT_88573 [Selag... 70 4e-10 emb|CAN63879.1| hypothetical protein VITISV_032250 [Vitis vinifera] 67 6e-09 ref|XP_006838377.1| PREDICTED: phosphatidylinositol 4-phosphate ... 66 8e-09 ref|XP_012850309.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidyl... 66 1e-08 ref|XP_011464853.1| PREDICTED: phosphatidylinositol 4-phosphate ... 66 1e-08 gb|EYU26541.1| hypothetical protein MIMGU_mgv1a001773mg [Erythra... 66 1e-08 ref|XP_004503007.1| PREDICTED: phosphatidylinositol 4-phosphate ... 66 1e-08 ref|XP_004299942.1| PREDICTED: phosphatidylinositol 4-phosphate ... 66 1e-08 ref|NP_187603.1| phosphatidyl inositol monophosphate 5 kinase [A... 65 2e-08 ref|XP_012071342.1| PREDICTED: phosphatidylinositol 4-phosphate ... 65 2e-08 ref|XP_011092347.1| PREDICTED: phosphatidylinositol 4-phosphate ... 65 2e-08 ref|XP_010543450.1| PREDICTED: phosphatidylinositol 4-phosphate ... 65 2e-08 ref|XP_010486568.1| PREDICTED: phosphatidylinositol 4-phosphate ... 65 2e-08 ref|XP_010464651.1| PREDICTED: phosphatidylinositol 4-phosphate ... 65 2e-08 ref|XP_010478747.1| PREDICTED: phosphatidylinositol 4-phosphate ... 65 2e-08 ref|XP_011655253.1| PREDICTED: phosphatidylinositol 4-phosphate ... 65 2e-08 ref|XP_009146887.1| PREDICTED: phosphatidylinositol 4-phosphate ... 65 2e-08 emb|CDY41570.1| BnaC05g43070D [Brassica napus] 65 2e-08 emb|CDY54607.1| BnaA05g28620D [Brassica napus] 65 2e-08 >ref|XP_002963939.1| hypothetical protein SELMODRAFT_230263 [Selaginella moellendorffii] gi|300167668|gb|EFJ34272.1| hypothetical protein SELMODRAFT_230263 [Selaginella moellendorffii] Length = 764 Score = 70.5 bits (171), Expect = 4e-10 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIE 159 S+CGN+ REL+SPGKSG + YLSHDDRF+IKTMRKSE+E Sbjct: 433 SLCGNDALRELSSPGKSGSVFYLSHDDRFIIKTMRKSEVE 472 >ref|XP_002967980.1| hypothetical protein SELMODRAFT_88573 [Selaginella moellendorffii] gi|300164718|gb|EFJ31327.1| hypothetical protein SELMODRAFT_88573 [Selaginella moellendorffii] Length = 770 Score = 70.5 bits (171), Expect = 4e-10 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIE 159 S+CGN+ REL+SPGKSG + YLSHDDRF+IKTMRKSE+E Sbjct: 433 SLCGNDALRELSSPGKSGSVFYLSHDDRFIIKTMRKSEVE 472 >emb|CAN63879.1| hypothetical protein VITISV_032250 [Vitis vinifera] Length = 605 Score = 66.6 bits (161), Expect = 6e-09 Identities = 31/51 (60%), Positives = 40/51 (78%), Gaps = 3/51 (5%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIERC---WILEIF 135 SICGN+ REL+SPGKSG + +LS DD F+IKT+RKSE++ C WIL I+ Sbjct: 553 SICGNDALRELSSPGKSGSVFFLSQDDHFMIKTLRKSEVKVCHLYWILCIY 603 >ref|XP_006838377.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1 [Amborella trichopoda] gi|548840883|gb|ERN00946.1| hypothetical protein AMTR_s00002p00056060 [Amborella trichopoda] Length = 695 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIE 159 SICGN+ REL+SPGKSG YL+HDDRF+IKTM+KSE++ Sbjct: 396 SICGNDALRELSSPGKSGSFFYLTHDDRFMIKTMKKSEVK 435 >ref|XP_012850309.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 4-phosphate 5-kinase 8-like [Erythranthe guttatus] Length = 771 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIE 159 SICG++ REL+SPGKSG L YLSHDDRFVIKT++KSE++ Sbjct: 432 SICGDDGLRELSSPGKSGSLFYLSHDDRFVIKTLKKSELK 471 >ref|XP_011464853.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8 isoform X1 [Fragaria vesca subsp. vesca] Length = 769 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIE 159 SICG++ REL+SPGKSG L YLSHDDRFVIKT++KSE++ Sbjct: 435 SICGDDGLRELSSPGKSGSLFYLSHDDRFVIKTLKKSELK 474 >gb|EYU26541.1| hypothetical protein MIMGU_mgv1a001773mg [Erythranthe guttata] Length = 761 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIE 159 SICG++ REL+SPGKSG L YLSHDDRFVIKT++KSE++ Sbjct: 422 SICGDDGLRELSSPGKSGSLFYLSHDDRFVIKTLKKSELK 461 >ref|XP_004503007.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Cicer arietinum] Length = 712 Score = 65.9 bits (159), Expect = 1e-08 Identities = 26/40 (65%), Positives = 36/40 (90%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIE 159 +ICGN+T RE++SPGKSG YL+HDDRF+IKT++KSE++ Sbjct: 405 AICGNDTLREMSSPGKSGSFFYLTHDDRFIIKTLKKSEVK 444 >ref|XP_004299942.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8 isoform X2 [Fragaria vesca subsp. vesca] Length = 767 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIE 159 SICG++ REL+SPGKSG L YLSHDDRFVIKT++KSE++ Sbjct: 435 SICGDDGLRELSSPGKSGSLFYLSHDDRFVIKTLKKSELK 474 >ref|NP_187603.1| phosphatidyl inositol monophosphate 5 kinase [Arabidopsis thaliana] gi|79313173|ref|NP_001030666.1| phosphatidyl inositol monophosphate 5 kinase [Arabidopsis thaliana] gi|334185202|ref|NP_001189852.1| phosphatidyl inositol monophosphate 5 kinase [Arabidopsis thaliana] gi|78099094|sp|Q8L850.2|PI5K9_ARATH RecName: Full=Phosphatidylinositol 4-phosphate 5-kinase 9; Short=AtPIP5K9; AltName: Full=1-phosphatidylinositol 4-phosphate kinase 9; AltName: Full=Diphosphoinositide kinase 9; AltName: Full=PtdIns(4)P-5-kinase 9 gi|6681327|gb|AAF23244.1|AC015985_2 putative phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis thaliana] gi|51490699|emb|CAH18644.1| putative phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis thaliana] gi|110739473|dbj|BAF01646.1| putative phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis thaliana] gi|332641311|gb|AEE74832.1| phosphatidyl inositol monophosphate 5 kinase [Arabidopsis thaliana] gi|332641312|gb|AEE74833.1| phosphatidyl inositol monophosphate 5 kinase [Arabidopsis thaliana] gi|332641313|gb|AEE74834.1| phosphatidyl inositol monophosphate 5 kinase [Arabidopsis thaliana] Length = 815 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIE 159 SICGN+T REL+SPGKSG + +LS DDRF+IKT+RKSE++ Sbjct: 478 SICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVK 517 >ref|XP_012071342.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like isoform X2 [Jatropha curcas] Length = 764 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIE 159 SICG++ REL+SPGKSG + YLSHDDRFVIKT++KSE++ Sbjct: 426 SICGDDGLRELSSPGKSGSIFYLSHDDRFVIKTLKKSELK 465 >ref|XP_011092347.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Sesamum indicum] gi|747089425|ref|XP_011092349.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Sesamum indicum] Length = 767 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIE 159 SICG++ REL SPGKSG L YLSHDDRFVIKT++KSE++ Sbjct: 433 SICGDDGLRELCSPGKSGSLFYLSHDDRFVIKTLKKSELK 472 >ref|XP_010543450.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform X1 [Tarenaya hassleriana] gi|729351084|ref|XP_010543451.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform X2 [Tarenaya hassleriana] gi|729351087|ref|XP_010543452.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like isoform X1 [Tarenaya hassleriana] Length = 823 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIE 159 SICGN+T REL+SPGKSG + +LS DDRF+IKT+RKSE++ Sbjct: 489 SICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVK 528 >ref|XP_010486568.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Camelina sativa] gi|727631133|ref|XP_010486569.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Camelina sativa] Length = 816 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIE 159 SICGN+T REL+SPGKSG + +LS DDRF+IKT+RKSE++ Sbjct: 479 SICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVK 518 >ref|XP_010464651.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Camelina sativa] Length = 816 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIE 159 SICGN+T REL+SPGKSG + +LS DDRF+IKT+RKSE++ Sbjct: 479 SICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVK 518 >ref|XP_010478747.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Camelina sativa] Length = 815 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIE 159 SICGN+T REL+SPGKSG + +LS DDRF+IKT+RKSE++ Sbjct: 478 SICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVK 517 >ref|XP_011655253.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 6-like [Cucumis sativus] gi|778702733|ref|XP_011655254.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 6-like [Cucumis sativus] gi|700195915|gb|KGN51092.1| hypothetical protein Csa_5G435070 [Cucumis sativus] Length = 743 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIE 159 SICGN+ REL+SPGKSG YL+HDDR++IKTMRK+E++ Sbjct: 438 SICGNDALRELSSPGKSGSFFYLTHDDRYMIKTMRKAEVK 477 >ref|XP_009146887.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9 [Brassica rapa] Length = 817 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIE 159 SICGN+T REL+SPGKSG + +LS DDRF+IKT+RKSE++ Sbjct: 481 SICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVK 520 >emb|CDY41570.1| BnaC05g43070D [Brassica napus] Length = 818 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIE 159 SICGN+T REL+SPGKSG + +LS DDRF+IKT+RKSE++ Sbjct: 482 SICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVK 521 >emb|CDY54607.1| BnaA05g28620D [Brassica napus] Length = 816 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -2 Query: 278 SICGNETFRELTSPGKSGCLLYLSHDDRFVIKTMRKSEIE 159 SICGN+T REL+SPGKSG + +LS DDRF+IKT+RKSE++ Sbjct: 480 SICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVK 519