BLASTX nr result
ID: Cinnamomum23_contig00024319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00024319 (210 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857897.1| PREDICTED: BAG family molecular chaperone re... 59 1e-06 ref|XP_010933885.1| PREDICTED: BAG family molecular chaperone re... 57 5e-06 >ref|XP_006857897.1| PREDICTED: BAG family molecular chaperone regulator 1 [Amborella trichopoda] gi|548861999|gb|ERN19364.1| hypothetical protein AMTR_s00069p00126080 [Amborella trichopoda] Length = 272 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/51 (50%), Positives = 40/51 (78%) Frame = -2 Query: 170 NSDLSVETKSRVRRVRKYVETLDLLKIRNAMPNRAQQQQKNSVVVTTKWSS 18 + D+ ++ + +V+RV+KYVETLD+LKIRN++PN Q++ VVVTTKW + Sbjct: 201 DGDVKLQRRIQVKRVQKYVETLDMLKIRNSIPNGHIPQRQGPVVVTTKWET 251 >ref|XP_010933885.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Elaeis guineensis] Length = 300 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 8/59 (13%) Frame = -2 Query: 170 NSDLSVETKSRVRRVRKYVETLDLLKIRNAMPN--------RAQQQQKNSVVVTTKWSS 18 + DL ++ + + RRV+KYVETLD+LKI+NA+P R Q+Q+ SVVVTTKW + Sbjct: 206 DGDLKLQRRMQERRVQKYVETLDVLKIKNALPRAANQRTPARQPQKQQPSVVVTTKWET 264