BLASTX nr result
ID: Cinnamomum23_contig00024196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00024196 (261 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010240953.1| PREDICTED: pentatricopeptide repeat-containi... 83 6e-14 ref|XP_012070732.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-10 ref|XP_011627630.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_010644336.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 gb|ERN17305.1| hypothetical protein AMTR_s00037p00059950 [Ambore... 69 2e-09 gb|KJB13584.1| hypothetical protein B456_002G082600 [Gossypium r... 67 6e-09 gb|KJB13582.1| hypothetical protein B456_002G082600 [Gossypium r... 67 6e-09 ref|XP_012459896.1| PREDICTED: pentatricopeptide repeat-containi... 67 6e-09 ref|XP_008244351.1| PREDICTED: pentatricopeptide repeat-containi... 66 8e-09 ref|XP_008801381.1| PREDICTED: pentatricopeptide repeat-containi... 63 9e-08 ref|XP_006360089.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 emb|CDP05799.1| unnamed protein product [Coffea canephora] 61 3e-07 ref|XP_009418432.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_009418425.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_011097923.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_010324329.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 ref|XP_004244155.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 ref|XP_010062970.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-07 gb|KCW70130.1| hypothetical protein EUGRSUZ_F03427 [Eucalyptus g... 60 8e-07 ref|XP_010694249.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 >ref|XP_010240953.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Nelumbo nucifera] Length = 872 Score = 83.2 bits (204), Expect = 6e-14 Identities = 39/67 (58%), Positives = 50/67 (74%) Frame = -3 Query: 202 QMPIERKLFDNVLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQ 23 Q+P + + + VLNIPW ++ S T RK++SRERK +WIFKNTQ HRF +LV+M AQ Sbjct: 127 QLPNDERTIEKVLNIPWFTNMSPTSILQRRKDISRERKQKWIFKNTQTHRFQKLVKMCAQ 186 Query: 22 KLGTEAT 2 KLGTEAT Sbjct: 187 KLGTEAT 193 >ref|XP_012070732.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Jatropha curcas] gi|643731858|gb|KDP39050.1| hypothetical protein JCGZ_00807 [Jatropha curcas] Length = 886 Score = 70.1 bits (170), Expect = 6e-10 Identities = 34/62 (54%), Positives = 46/62 (74%) Frame = -3 Query: 187 RKLFDNVLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQKLGTE 8 +K +N L+IPW S+ S S RKEL R RKG WIFK+TQ++RFD+LV+M +K+GT+ Sbjct: 146 KKTSENKLDIPWISNLSHKNVSVYRKELCRVRKGTWIFKSTQVNRFDKLVKMCGEKIGTD 205 Query: 7 AT 2 AT Sbjct: 206 AT 207 >ref|XP_011627630.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial [Amborella trichopoda] Length = 496 Score = 68.6 bits (166), Expect = 2e-09 Identities = 35/58 (60%), Positives = 41/58 (70%) Frame = -3 Query: 175 DNVLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQKLGTEAT 2 +N L IPW SD S RKEL RERK +WIFKNTQ RF++LV++ A KLGTEAT Sbjct: 78 ENALVIPWFSDVLHPNISQRRKELLRERKKKWIFKNTQNRRFERLVKLCADKLGTEAT 135 >ref|XP_010644336.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Vitis vinifera] Length = 842 Score = 68.6 bits (166), Expect = 2e-09 Identities = 35/67 (52%), Positives = 45/67 (67%) Frame = -3 Query: 202 QMPIERKLFDNVLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQ 23 Q+ + K + VL++PW S S RKE+SRERK +W+FKNTQ R D+LV+ AQ Sbjct: 91 QLTNDEKPLEKVLDVPWFPTLSHNNISLRRKEVSRERKQKWVFKNTQGGRLDRLVKTCAQ 150 Query: 22 KLGTEAT 2 KLGTEAT Sbjct: 151 KLGTEAT 157 >gb|ERN17305.1| hypothetical protein AMTR_s00037p00059950 [Amborella trichopoda] Length = 733 Score = 68.6 bits (166), Expect = 2e-09 Identities = 35/58 (60%), Positives = 41/58 (70%) Frame = -3 Query: 175 DNVLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQKLGTEAT 2 +N L IPW SD S RKEL RERK +WIFKNTQ RF++LV++ A KLGTEAT Sbjct: 78 ENALVIPWFSDVLHPNISQRRKELLRERKKKWIFKNTQNRRFERLVKLCADKLGTEAT 135 >gb|KJB13584.1| hypothetical protein B456_002G082600 [Gossypium raimondii] Length = 748 Score = 66.6 bits (161), Expect = 6e-09 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = -3 Query: 169 VLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQKLGTEAT 2 VLNIPW S+ S S RKELSRERK +W+FK TQ RF++L++M KLGT+AT Sbjct: 11 VLNIPWLSNVSNNNISLRRKELSRERKQKWVFKKTQSGRFNRLIKMCGDKLGTKAT 66 >gb|KJB13582.1| hypothetical protein B456_002G082600 [Gossypium raimondii] Length = 763 Score = 66.6 bits (161), Expect = 6e-09 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = -3 Query: 169 VLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQKLGTEAT 2 VLNIPW S+ S S RKELSRERK +W+FK TQ RF++L++M KLGT+AT Sbjct: 127 VLNIPWLSNVSNNNISLRRKELSRERKQKWVFKKTQSGRFNRLIKMCGDKLGTKAT 182 >ref|XP_012459896.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial [Gossypium raimondii] gi|763746142|gb|KJB13581.1| hypothetical protein B456_002G082600 [Gossypium raimondii] Length = 864 Score = 66.6 bits (161), Expect = 6e-09 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = -3 Query: 169 VLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQKLGTEAT 2 VLNIPW S+ S S RKELSRERK +W+FK TQ RF++L++M KLGT+AT Sbjct: 127 VLNIPWLSNVSNNNISLRRKELSRERKQKWVFKKTQSGRFNRLIKMCGDKLGTKAT 182 >ref|XP_008244351.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Prunus mume] Length = 868 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/63 (47%), Positives = 44/63 (69%) Frame = -3 Query: 190 ERKLFDNVLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQKLGT 11 + K +N L++PW D S + S RKE++RERK +WIFK++Q++RF +LV M A +LGT Sbjct: 134 DEKSMENALDLPWFPDMSHSVLSMRRKEITRERKQKWIFKSSQVNRFGRLVNMCADRLGT 193 Query: 10 EAT 2 T Sbjct: 194 HTT 196 >ref|XP_008801381.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Phoenix dactylifera] Length = 963 Score = 62.8 bits (151), Expect = 9e-08 Identities = 29/60 (48%), Positives = 44/60 (73%) Frame = -3 Query: 181 LFDNVLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQKLGTEAT 2 + +L++PW S+ S T ++ RK++SR RK ++IFKNT+ RF +L+RM A KLGTE+T Sbjct: 116 MLKKILDLPWFSNMSHTGTAQWRKDVSRGRKQKYIFKNTESRRFTKLMRMCANKLGTEST 175 >ref|XP_006360089.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565388658|ref|XP_006360090.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565388660|ref|XP_006360091.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X3 [Solanum tuberosum] Length = 850 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/58 (51%), Positives = 41/58 (70%) Frame = -3 Query: 175 DNVLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQKLGTEAT 2 +NVL++PW S+ S RKE++RERK +W FK+TQ+ RF QLV+ A KLGT+ T Sbjct: 107 ENVLDVPWLSNVEKCNMSLRRKEIARERKEKWTFKSTQIGRFHQLVKQCACKLGTDTT 164 >emb|CDP05799.1| unnamed protein product [Coffea canephora] Length = 1302 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/59 (50%), Positives = 40/59 (67%) Frame = -3 Query: 178 FDNVLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQKLGTEAT 2 F NVL+ PW S + S RKE+SRERK +WIF ++Q +RFD+L M +KLG +AT Sbjct: 512 FSNVLHDPWISRSAENNISLRRKEISRERKQKWIFSSSQKNRFDRLTTMCGEKLGPDAT 570 >ref|XP_009418432.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 843 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/60 (46%), Positives = 43/60 (71%) Frame = -3 Query: 181 LFDNVLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQKLGTEAT 2 L N+L++PW S S ++ +KE+SRERK ++IFKNT+ RF +L++ A KLGT++T Sbjct: 121 LLKNILDVPWFSSMSQINTTQWKKEVSRERKQKYIFKNTESRRFVELMKKCADKLGTKST 180 >ref|XP_009418425.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 845 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/60 (46%), Positives = 43/60 (71%) Frame = -3 Query: 181 LFDNVLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQKLGTEAT 2 L N+L++PW S S ++ +KE+SRERK ++IFKNT+ RF +L++ A KLGT++T Sbjct: 123 LLKNILDVPWFSSMSQINTTQWKKEVSRERKQKYIFKNTESRRFVELMKKCADKLGTKST 182 >ref|XP_011097923.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Sesamum indicum] Length = 904 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/56 (53%), Positives = 39/56 (69%) Frame = -3 Query: 169 VLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQKLGTEAT 2 V++ PW S S S RKE+SRERK +W+FKN Q RF +LV+M A+KLG +AT Sbjct: 159 VMDFPWLSRMSNINISLRRKEVSRERKQKWVFKNAQTSRFGRLVKMCARKLGPDAT 214 >ref|XP_010324329.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X1 [Solanum lycopersicum] gi|723718433|ref|XP_010324330.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X1 [Solanum lycopersicum] Length = 867 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/58 (50%), Positives = 40/58 (68%) Frame = -3 Query: 175 DNVLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQKLGTEAT 2 +NVL++PW S+ S RKE++RERK +W FK++Q+ RF QLV A KLGT+ T Sbjct: 124 ENVLDVPWLSNVEKCSISLRRKEIARERKEKWTFKSSQVGRFHQLVEQCACKLGTDTT 181 >ref|XP_004244155.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X2 [Solanum lycopersicum] Length = 850 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/58 (50%), Positives = 40/58 (68%) Frame = -3 Query: 175 DNVLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQKLGTEAT 2 +NVL++PW S+ S RKE++RERK +W FK++Q+ RF QLV A KLGT+ T Sbjct: 107 ENVLDVPWLSNVEKCSISLRRKEIARERKEKWTFKSSQVGRFHQLVEQCACKLGTDTT 164 >ref|XP_010062970.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Eucalyptus grandis] Length = 878 Score = 59.7 bits (143), Expect = 8e-07 Identities = 33/61 (54%), Positives = 41/61 (67%) Frame = -3 Query: 184 KLFDNVLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQKLGTEA 5 K + VL+ P +D S + L KE RERK RWIFKNT + R+D+LV+M AQ LGTEA Sbjct: 130 KSLEEVLSKPLFADMS-QAKALLHKEALRERKQRWIFKNTLVRRYDRLVKMCAQVLGTEA 188 Query: 4 T 2 T Sbjct: 189 T 189 >gb|KCW70130.1| hypothetical protein EUGRSUZ_F03427 [Eucalyptus grandis] Length = 774 Score = 59.7 bits (143), Expect = 8e-07 Identities = 33/61 (54%), Positives = 41/61 (67%) Frame = -3 Query: 184 KLFDNVLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQKLGTEA 5 K + VL+ P +D S + L KE RERK RWIFKNT + R+D+LV+M AQ LGTEA Sbjct: 26 KSLEEVLSKPLFADMS-QAKALLHKEALRERKQRWIFKNTLVRRYDRLVKMCAQVLGTEA 84 Query: 4 T 2 T Sbjct: 85 T 85 >ref|XP_010694249.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like isoform X2 [Beta vulgaris subsp. vulgaris] Length = 863 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/61 (47%), Positives = 41/61 (67%) Frame = -3 Query: 184 KLFDNVLNIPWGSDKSITCSSPLRKELSRERKGRWIFKNTQMHRFDQLVRMSAQKLGTEA 5 K ++ ++PW S+ + S RKELSR+RK +WIFKNTQ RFD+LV M K+G+ + Sbjct: 120 KALEDDSDLPWFSNLFNSSMSLRRKELSRDRKNKWIFKNTQKLRFDKLVNMCLDKVGSGS 179 Query: 4 T 2 T Sbjct: 180 T 180