BLASTX nr result
ID: Cinnamomum23_contig00023845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00023845 (215 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086789.1| PREDICTED: chlorophyll a-b binding protein, ... 73 8e-11 gb|EPS71951.1| chlorophyll a-b binding protein 7, chloroplastic,... 67 5e-09 ref|XP_012851204.1| PREDICTED: chlorophyll a-b binding protein, ... 67 6e-09 ref|XP_011002123.1| PREDICTED: chlorophyll a-b binding protein 7... 67 6e-09 ref|XP_011036086.1| PREDICTED: chlorophyll a-b binding protein 7... 67 6e-09 gb|EYU25891.1| hypothetical protein MIMGU_mgv1a025195mg, partial... 67 6e-09 ref|XP_012085680.1| PREDICTED: chlorophyll a-b binding protein 7... 66 8e-09 ref|XP_002299309.1| chlorophyll a/b-binding protein type II prec... 66 1e-08 gb|ABK95596.1| unknown [Populus trichocarpa] 66 1e-08 ref|XP_006352516.1| PREDICTED: chlorophyll a-b binding protein 7... 63 9e-08 ref|XP_011020754.1| PREDICTED: chlorophyll a-b binding protein 7... 62 1e-07 ref|NP_001296176.1| chlorophyll a-b binding protein 7, chloropla... 62 1e-07 gb|ABK95601.1| unknown [Populus trichocarpa] 62 2e-07 ref|XP_002303791.1| chlorophyll a/b-binding protein type II prec... 61 3e-07 ref|XP_002514914.1| chlorophyll A/B binding protein, putative [R... 60 6e-07 ref|XP_009787153.1| PREDICTED: chlorophyll a-b binding protein, ... 60 7e-07 ref|XP_007044017.1| Chlorophyll a-b binding protein 7, chloropla... 60 7e-07 gb|KDO81901.1| hypothetical protein CISIN_1g024422mg [Citrus sin... 59 1e-06 gb|KDO81899.1| hypothetical protein CISIN_1g024422mg [Citrus sin... 59 1e-06 ref|XP_006484100.1| PREDICTED: chlorophyll a-b binding protein, ... 59 1e-06 >ref|XP_011086789.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Sesamum indicum] Length = 271 Score = 72.8 bits (177), Expect = 8e-11 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -3 Query: 129 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGS 1 ATKASF GRKLRVSK A +G RSVTVC+A DPDRPLWFPGS Sbjct: 31 ATKASFFGGRKLRVSKFAAPSGTRSVTVCAAADPDRPLWFPGS 73 >gb|EPS71951.1| chlorophyll a-b binding protein 7, chloroplastic, partial [Genlisea aurea] Length = 259 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/47 (68%), Positives = 36/47 (76%) Frame = -3 Query: 141 SSTRATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGS 1 SS ATKASF RKLRV K +T++ RSV+VC A DPDRPLWFPGS Sbjct: 15 SSVGATKASFFGARKLRVGKFSTTSSSRSVSVCVAADPDRPLWFPGS 61 >ref|XP_012851204.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic isoform X1 [Erythranthe guttatus] gi|848902579|ref|XP_012851205.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic isoform X2 [Erythranthe guttatus] Length = 270 Score = 66.6 bits (161), Expect = 6e-09 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = -3 Query: 129 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGS 1 ATKASF GRKLRVSK A + RSV VC A DPDRP+WFPGS Sbjct: 30 ATKASFFGGRKLRVSKFAAPSNTRSVAVCVAADPDRPIWFPGS 72 >ref|XP_011002123.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Populus euphratica] Length = 269 Score = 66.6 bits (161), Expect = 6e-09 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 129 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGS 1 +TKASFLSG+KLR+ + T RSVTVC A DPDRPLWFPGS Sbjct: 29 STKASFLSGKKLRLKRYTTPTAARSVTVCVAADPDRPLWFPGS 71 >ref|XP_011036086.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like [Populus euphratica] Length = 269 Score = 66.6 bits (161), Expect = 6e-09 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 129 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGS 1 +TKASFLSG+KLR+ + T RSVTVC A DPDRPLWFPGS Sbjct: 29 STKASFLSGKKLRLKRYTTPTAARSVTVCVAADPDRPLWFPGS 71 >gb|EYU25891.1| hypothetical protein MIMGU_mgv1a025195mg, partial [Erythranthe guttata] Length = 250 Score = 66.6 bits (161), Expect = 6e-09 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = -3 Query: 129 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGS 1 ATKASF GRKLRVSK A + RSV VC A DPDRP+WFPGS Sbjct: 10 ATKASFFGGRKLRVSKFAAPSNTRSVAVCVAADPDRPIWFPGS 52 >ref|XP_012085680.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Jatropha curcas] gi|643714139|gb|KDP26804.1| hypothetical protein JCGZ_17962 [Jatropha curcas] Length = 270 Score = 66.2 bits (160), Expect = 8e-09 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = -3 Query: 129 ATKASFLSGRKLRVSKNATSNGV-RSVTVCSAPDPDRPLWFPGS 1 ATKASFLSG+KLR+ N +S V RSVTVC+A DPDRPLWFPGS Sbjct: 29 ATKASFLSGKKLRLRSNTSSPVVSRSVTVCAAADPDRPLWFPGS 72 >ref|XP_002299309.1| chlorophyll a/b-binding protein type II precursor [Populus trichocarpa] gi|222846567|gb|EEE84114.1| chlorophyll a/b-binding protein type II precursor [Populus trichocarpa] Length = 272 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 129 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGS 1 +TKASFLSG+KLR+ K RSVTVC A DPDRPLWFPGS Sbjct: 32 STKASFLSGKKLRLKKYTAPTAARSVTVCVAADPDRPLWFPGS 74 >gb|ABK95596.1| unknown [Populus trichocarpa] Length = 269 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 129 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGS 1 +TKASFLSG+KLR+ K RSVTVC A DPDRPLWFPGS Sbjct: 29 STKASFLSGKKLRLKKYTAPTAARSVTVCVAADPDRPLWFPGS 71 >ref|XP_006352516.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like [Solanum tuberosum] Length = 270 Score = 62.8 bits (151), Expect = 9e-08 Identities = 31/44 (70%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = -3 Query: 129 ATKASFLSGRKLRVSKNATSNGVRSVT-VCSAPDPDRPLWFPGS 1 ATKASFL GR+LRVSK +T+ RS T VC A +PDRPLWFPGS Sbjct: 29 ATKASFLGGRRLRVSKYSTTPAARSATTVCVAAEPDRPLWFPGS 72 >ref|XP_011020754.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like [Populus euphratica] Length = 269 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -3 Query: 129 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGS 1 +TKASFL G+KLR+ + RSVTVC A DPDRPLWFPGS Sbjct: 29 STKASFLRGKKLRLKTYTSPTAARSVTVCVAADPDRPLWFPGS 71 >ref|NP_001296176.1| chlorophyll a-b binding protein 7, chloroplastic [Solanum lycopersicum] gi|115765|sp|P10708.1|CB12_SOLLC RecName: Full=Chlorophyll a-b binding protein 7, chloroplastic; AltName: Full=LHCI type II CAB-7; Flags: Precursor gi|19180|emb|CAA32197.1| chlorophyll a/b-binding protein [Solanum lycopersicum] gi|170431|gb|AAA34159.1| chlorophyll a/b-binding protein [Solanum lycopersicum] gi|226546|prf||1601518A chlorophyll a/b binding protein II Length = 270 Score = 62.0 bits (149), Expect = 1e-07 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -3 Query: 126 TKASFLSGRKLRVSKNATSNGVRSVT-VCSAPDPDRPLWFPGS 1 TKASFL GR+LRVSK +T+ RS T VC A DPDRPLWFPGS Sbjct: 30 TKASFLGGRRLRVSKYSTTPTARSATTVCVAADPDRPLWFPGS 72 >gb|ABK95601.1| unknown [Populus trichocarpa] Length = 269 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -3 Query: 129 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGS 1 +TKASFL G+KLR+ + RSVTVC A DPDRPLWFPGS Sbjct: 29 STKASFLRGKKLRLRTYTSPTAARSVTVCVAADPDRPLWFPGS 71 >ref|XP_002303791.1| chlorophyll a/b-binding protein type II precursor [Populus trichocarpa] gi|222841223|gb|EEE78770.1| chlorophyll a/b-binding protein type II precursor [Populus trichocarpa] Length = 269 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/43 (65%), Positives = 31/43 (72%) Frame = -3 Query: 129 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGS 1 +TKASFL G KLR+ + RSVTVC A DPDRPLWFPGS Sbjct: 29 STKASFLRGEKLRLRTYTSPTAARSVTVCVAADPDRPLWFPGS 71 >ref|XP_002514914.1| chlorophyll A/B binding protein, putative [Ricinus communis] gi|223545965|gb|EEF47468.1| chlorophyll A/B binding protein, putative [Ricinus communis] Length = 270 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/48 (62%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = -3 Query: 141 SSTRATKASFLSGRKLRVSKNATSN-GVRSVTVCSAPDPDRPLWFPGS 1 S+ ATKASFLSG++L V K+ + RSVTVC+ DPDRPLWFPGS Sbjct: 25 STVGATKASFLSGKRLTVRKHTSPVVASRSVTVCAVADPDRPLWFPGS 72 >ref|XP_009787153.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Nicotiana sylvestris] gi|698567424|ref|XP_009773771.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Nicotiana sylvestris] Length = 270 Score = 59.7 bits (143), Expect = 7e-07 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = -3 Query: 129 ATKASFLSGRKLRVSKNATSNGVRSVTVCS-APDPDRPLWFPGS 1 ATKASFL G++LRVSK+ G RSV V + A DPDRPLWFPGS Sbjct: 29 ATKASFLGGKRLRVSKHVAPAGSRSVAVSAVAADPDRPLWFPGS 72 >ref|XP_007044017.1| Chlorophyll a-b binding protein 7, chloroplastic [Theobroma cacao] gi|508707952|gb|EOX99848.1| Chlorophyll a-b binding protein 7, chloroplastic [Theobroma cacao] Length = 271 Score = 59.7 bits (143), Expect = 7e-07 Identities = 29/45 (64%), Positives = 35/45 (77%), Gaps = 2/45 (4%) Frame = -3 Query: 129 ATKASFLSGRKLRVSK--NATSNGVRSVTVCSAPDPDRPLWFPGS 1 ATKASFLSG+KLR ++ +A G R V VC+A DP+RPLWFPGS Sbjct: 29 ATKASFLSGKKLRSARKYSAAPAGARPVAVCAAADPNRPLWFPGS 73 >gb|KDO81901.1| hypothetical protein CISIN_1g024422mg [Citrus sinensis] gi|641863216|gb|KDO81902.1| hypothetical protein CISIN_1g024422mg [Citrus sinensis] Length = 265 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/44 (63%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = -3 Query: 129 ATKASFLSGRKLRVSKNATSNGVRSVTV-CSAPDPDRPLWFPGS 1 ATKASFL G+KL++ KN + G RSV+V +A DP+RPLWFPGS Sbjct: 27 ATKASFLGGKKLKLRKNGATAGTRSVSVSAAAADPNRPLWFPGS 70 >gb|KDO81899.1| hypothetical protein CISIN_1g024422mg [Citrus sinensis] Length = 255 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/44 (63%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = -3 Query: 129 ATKASFLSGRKLRVSKNATSNGVRSVTV-CSAPDPDRPLWFPGS 1 ATKASFL G+KL++ KN + G RSV+V +A DP+RPLWFPGS Sbjct: 27 ATKASFLGGKKLKLRKNGATAGTRSVSVSAAAADPNRPLWFPGS 70 >ref|XP_006484100.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like [Citrus sinensis] gi|641863214|gb|KDO81900.1| hypothetical protein CISIN_1g024422mg [Citrus sinensis] Length = 268 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/44 (63%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = -3 Query: 129 ATKASFLSGRKLRVSKNATSNGVRSVTV-CSAPDPDRPLWFPGS 1 ATKASFL G+KL++ KN + G RSV+V +A DP+RPLWFPGS Sbjct: 27 ATKASFLGGKKLKLRKNGATAGTRSVSVSAAAADPNRPLWFPGS 70