BLASTX nr result
ID: Cinnamomum23_contig00022798
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00022798 (387 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP10275.1| unnamed protein product [Coffea canephora] 59 1e-06 ref|XP_010908319.1| PREDICTED: cytochrome b561 and DOMON domain-... 58 3e-06 ref|XP_010241773.1| PREDICTED: cytochrome b561 and DOMON domain-... 56 8e-06 >emb|CDP10275.1| unnamed protein product [Coffea canephora] Length = 398 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 118 PSHSTTTNCSSQTFSRNRIFQTCNNLPQLNSSLHWTYN 5 PS+S T C+SQ F RNRIFQ CN+LPQLNS +HWTY+ Sbjct: 22 PSYSAT--CTSQKFGRNRIFQHCNDLPQLNSHIHWTYD 57 >ref|XP_010908319.1| PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g25290-like [Elaeis guineensis] Length = 394 Score = 57.8 bits (138), Expect = 3e-06 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = -3 Query: 118 PSHSTTTNCSSQTFSRNRIFQTCNNLPQLNSSLHWTYN 5 P S + +C+SQTFS NR+F TCNNLP L+++LHWTY+ Sbjct: 15 PLPSFSQSCTSQTFSNNRLFATCNNLPHLSAALHWTYD 52 >ref|XP_010241773.1| PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g25290 [Nelumbo nucifera] Length = 394 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -3 Query: 115 SHSTTTNCSSQTFSRNRIFQTCNNLPQLNSSLHWTYN 5 SHS T CSSQTF+ NR+FQ CN+LP L+S LHWTY+ Sbjct: 24 SHSLT--CSSQTFTSNRLFQNCNDLPHLSSYLHWTYD 58