BLASTX nr result
ID: Cinnamomum23_contig00022782
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00022782 (427 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERN06442.1| hypothetical protein AMTR_s00016p00258280 [Ambore... 58 3e-06 >gb|ERN06442.1| hypothetical protein AMTR_s00016p00258280 [Amborella trichopoda] Length = 696 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/60 (45%), Positives = 42/60 (70%) Frame = -1 Query: 424 TFNKLVECLSLKDQFDDALLVLDTMLGMGWRVEASTFQLLINQLCKVSADRTGEFLENIL 245 TFN+++ECLSL D+ DDALLVL+ M MG+R++ L+++LC+ +A+ LE I+ Sbjct: 635 TFNRVIECLSLTDEVDDALLVLNLMFEMGFRLQLPVSNSLVSRLCQNTANDAETSLEEIM 694