BLASTX nr result
ID: Cinnamomum23_contig00022550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00022550 (249 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510248.1| conserved hypothetical protein [Ricinus comm... 56 8e-06 >ref|XP_002510248.1| conserved hypothetical protein [Ricinus communis] gi|223550949|gb|EEF52435.1| conserved hypothetical protein [Ricinus communis] Length = 228 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/64 (43%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Frame = +1 Query: 61 MTILNYEEPKSPPVLCKFIPSSLKDAFAQCYALYFRRQSSLSTKDESPASDVEDER-VIV 237 M + ++E+P +PP CKF+ ++LKDAF+ C RR S S ++E P SD++DE+ +IV Sbjct: 1 MGVFHHEDPPTPPKKCKFLAAALKDAFSNCSTC--RRLSISSPEEEHPTSDIDDEQELIV 58 Query: 238 LAVR 249 A+R Sbjct: 59 SAIR 62