BLASTX nr result
ID: Cinnamomum23_contig00022516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00022516 (284 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011397368.1| Chlorophyll a-b binding protein of LHCII typ... 103 6e-20 ref|XP_011398059.1| Chlorophyll a-b binding protein of LHCII typ... 100 6e-19 ref|XP_005651417.1| chlorophyll a/b-binding protein [Coccomyxa s... 98 2e-18 ref|WP_043700718.1| hypothetical protein, partial [Nocardia absc... 97 5e-18 ref|WP_043700712.1| hypothetical protein, partial [Nocardia absc... 95 2e-17 ref|XP_005651359.1| major light-harvesting complex II protein m1... 94 4e-17 ref|XP_005650981.1| chlorophyll a/b-binding protein [Coccomyxa s... 92 1e-16 gb|AAB70556.1| chlorophyll a/b binding protein [Tetraselmis sp. ... 88 3e-15 ref|XP_005644537.1| chlorophyll a/b-binding protein [Coccomyxa s... 86 7e-15 ref|XP_005845510.1| hypothetical protein CHLNCDRAFT_137219 [Chlo... 85 2e-14 ref|XP_005843949.1| hypothetical protein CHLNCDRAFT_59790 [Chlor... 85 2e-14 gb|ABD37899.1| light-harvesting chlorophyll-a/b binding protein ... 83 6e-14 ref|XP_002952704.1| light-harvesting chlorophyll a/b-binding pro... 82 1e-13 tpg|DAA05914.1| TPA_inf: chloroplast light-harvesting complex II... 82 1e-13 ref|XP_001693987.1| light-harvesting protein of photosystem II [... 82 2e-13 sp|P27517.1|CB2_DUNTE RecName: Full=Chlorophyll a-b binding prot... 81 3e-13 gb|ABD37910.1| light-harvesting chlorophyll-a/b binding protein ... 81 3e-13 gb|ABD91646.1| major light-harvesting chlorophyll a/b protein 2.... 81 3e-13 gb|ABD91647.1| major light-harvesting chlorophyll a/b protein 2.... 81 3e-13 sp|P14273.1|CB2_CHLRE RecName: Full=Chlorophyll a-b binding prot... 80 4e-13 >ref|XP_011397368.1| Chlorophyll a-b binding protein of LHCII type I, chloroplastic [Auxenochlorella protothecoides] gi|675352040|gb|KFM24480.1| Chlorophyll a-b binding protein of LHCII type I, chloroplastic [Auxenochlorella protothecoides] Length = 250 Score = 103 bits (256), Expect = 6e-20 Identities = 44/64 (68%), Positives = 52/64 (81%) Frame = -2 Query: 193 AQKSFLGSTLRPVAPTQGKGTRQVTRAAVEFYGPERAKWLGPFSENATPDYLTGEFAGDY 14 A ++ +G+TLR PT G+GTRQVTRAA EFYGP R KWLGPFS ++TPDYL GE+ GDY Sbjct: 4 AMRATMGTTLRSAVPTAGRGTRQVTRAAAEFYGPNRVKWLGPFSGDSTPDYLKGEYPGDY 63 Query: 13 GWDT 2 GWDT Sbjct: 64 GWDT 67 >ref|XP_011398059.1| Chlorophyll a-b binding protein of LHCII type I, chloroplastic [Auxenochlorella protothecoides] gi|675352728|gb|KFM25168.1| Chlorophyll a-b binding protein of LHCII type I, chloroplastic [Auxenochlorella protothecoides] Length = 252 Score = 99.8 bits (247), Expect = 6e-19 Identities = 44/62 (70%), Positives = 50/62 (80%) Frame = -2 Query: 187 KSFLGSTLRPVAPTQGKGTRQVTRAAVEFYGPERAKWLGPFSENATPDYLTGEFAGDYGW 8 +SF+G+ +R V P GKG RQVTRAAVEFYGP RAK+LGPFSE TP YL GE+ GDYGW Sbjct: 3 RSFVGTNIRQVVPKAGKGPRQVTRAAVEFYGPNRAKFLGPFSEGVTPSYLKGEYPGDYGW 62 Query: 7 DT 2 DT Sbjct: 63 DT 64 >ref|XP_005651417.1| chlorophyll a/b-binding protein [Coccomyxa subellipsoidea C-169] gi|384253398|gb|EIE26873.1| chlorophyll a/b-binding protein [Coccomyxa subellipsoidea C-169] Length = 250 Score = 97.8 bits (242), Expect = 2e-18 Identities = 46/69 (66%), Positives = 53/69 (76%) Frame = -2 Query: 208 MTSALAQKSFLGSTLRPVAPTQGKGTRQVTRAAVEFYGPERAKWLGPFSENATPDYLTGE 29 M SAL SF G++LR PT GKG RQVTRAA+EFYGP+RA +LGPF++ TP YL GE Sbjct: 1 MASALLCNSFAGASLRSAVPTAGKGNRQVTRAAIEFYGPDRATFLGPFTD--TPSYLNGE 58 Query: 28 FAGDYGWDT 2 F GDYGWDT Sbjct: 59 FPGDYGWDT 67 >ref|WP_043700718.1| hypothetical protein, partial [Nocardia abscessus] Length = 172 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/69 (65%), Positives = 55/69 (79%) Frame = -2 Query: 208 MTSALAQKSFLGSTLRPVAPTQGKGTRQVTRAAVEFYGPERAKWLGPFSENATPDYLTGE 29 M SAL +SFLG++LR PT+G+G +QVTRAA+EFYGP+RA +LGPF+E P YL GE Sbjct: 1 MASALMCQSFLGASLRSAVPTKGQGNKQVTRAAIEFYGPDRAGFLGPFTE--APSYLKGE 58 Query: 28 FAGDYGWDT 2 F GDYGWDT Sbjct: 59 FPGDYGWDT 67 >ref|WP_043700712.1| hypothetical protein, partial [Nocardia abscessus] Length = 149 Score = 94.7 bits (234), Expect = 2e-17 Identities = 43/69 (62%), Positives = 53/69 (76%) Frame = -2 Query: 208 MTSALAQKSFLGSTLRPVAPTQGKGTRQVTRAAVEFYGPERAKWLGPFSENATPDYLTGE 29 M S + K+FLG++L PT GKGT+QVTR AVEFYGP RA +LGPF++ +P YLTGE Sbjct: 1 MASTMMAKTFLGASLAKAVPTSGKGTKQVTRVAVEFYGPNRAGYLGPFTK--SPSYLTGE 58 Query: 28 FAGDYGWDT 2 + GDYGWDT Sbjct: 59 YPGDYGWDT 67 >ref|XP_005651359.1| major light-harvesting complex II protein m10 [Coccomyxa subellipsoidea C-169] gi|384253340|gb|EIE26815.1| major light-harvesting complex II protein m10 [Coccomyxa subellipsoidea C-169] Length = 250 Score = 94.0 bits (232), Expect = 4e-17 Identities = 42/69 (60%), Positives = 53/69 (76%) Frame = -2 Query: 208 MTSALAQKSFLGSTLRPVAPTQGKGTRQVTRAAVEFYGPERAKWLGPFSENATPDYLTGE 29 M S + K+FLG++L PT GKGT+QVTRAA+EFYGP RA +LGPF++ +P YL GE Sbjct: 1 MASTMMAKTFLGASLAKAVPTSGKGTKQVTRAAIEFYGPNRAGYLGPFTK--SPSYLNGE 58 Query: 28 FAGDYGWDT 2 + GDYGWDT Sbjct: 59 YPGDYGWDT 67 >ref|XP_005650981.1| chlorophyll a/b-binding protein [Coccomyxa subellipsoidea C-169] gi|384252962|gb|EIE26437.1| chlorophyll a/b-binding protein [Coccomyxa subellipsoidea C-169] Length = 245 Score = 92.0 bits (227), Expect = 1e-16 Identities = 41/62 (66%), Positives = 52/62 (83%) Frame = -2 Query: 187 KSFLGSTLRPVAPTQGKGTRQVTRAAVEFYGPERAKWLGPFSENATPDYLTGEFAGDYGW 8 +SFLG++LR PT+G+G +QVTRAA+EFYGP+RA +LGPF+E +P YL GEF GDYGW Sbjct: 3 QSFLGASLRSAVPTKGQGNKQVTRAAIEFYGPDRAGFLGPFTE--SPSYLKGEFPGDYGW 60 Query: 7 DT 2 DT Sbjct: 61 DT 62 >gb|AAB70556.1| chlorophyll a/b binding protein [Tetraselmis sp. RG-15] Length = 251 Score = 87.8 bits (216), Expect = 3e-15 Identities = 42/67 (62%), Positives = 52/67 (77%) Frame = -2 Query: 202 SALAQKSFLGSTLRPVAPTQGKGTRQVTRAAVEFYGPERAKWLGPFSENATPDYLTGEFA 23 +A+A +SF + V + +G +QVTRAAVEFYGP+RAKWLGPFS++ TP YLTGEF Sbjct: 2 AAVAARSFAATVAGQVGAS-ARGQKQVTRAAVEFYGPDRAKWLGPFSDD-TPSYLTGEFP 59 Query: 22 GDYGWDT 2 GDYGWDT Sbjct: 60 GDYGWDT 66 >ref|XP_005644537.1| chlorophyll a/b-binding protein [Coccomyxa subellipsoidea C-169] gi|384246503|gb|EIE19993.1| chlorophyll a/b-binding protein [Coccomyxa subellipsoidea C-169] Length = 254 Score = 86.3 bits (212), Expect = 7e-15 Identities = 40/69 (57%), Positives = 52/69 (75%) Frame = -2 Query: 208 MTSALAQKSFLGSTLRPVAPTQGKGTRQVTRAAVEFYGPERAKWLGPFSENATPDYLTGE 29 M SAL SF+ S R V+ + KG +QVTRA++E+YGP+R K+LGP+S+ ATP YL GE Sbjct: 1 MASALLSNSFVVSARRTVSSPKSKG-KQVTRASIEWYGPDRPKFLGPYSDGATPSYLKGE 59 Query: 28 FAGDYGWDT 2 + GDYGWDT Sbjct: 60 YPGDYGWDT 68 >ref|XP_005845510.1| hypothetical protein CHLNCDRAFT_137219 [Chlorella variabilis] gi|307105157|gb|EFN53408.1| hypothetical protein CHLNCDRAFT_137219 [Chlorella variabilis] Length = 258 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/64 (62%), Positives = 47/64 (73%) Frame = -2 Query: 193 AQKSFLGSTLRPVAPTQGKGTRQVTRAAVEFYGPERAKWLGPFSENATPDYLTGEFAGDY 14 A ++F G T R + K +QVTRA+VEFYGP+RAK+LGPFSE A P YL GEF GDY Sbjct: 7 ASRAFTGITARQ-STKSAKARKQVTRASVEFYGPDRAKFLGPFSEGAVPSYLKGEFPGDY 65 Query: 13 GWDT 2 GWDT Sbjct: 66 GWDT 69 >ref|XP_005843949.1| hypothetical protein CHLNCDRAFT_59790 [Chlorella variabilis] gi|307103588|gb|EFN51847.1| hypothetical protein CHLNCDRAFT_59790 [Chlorella variabilis] Length = 251 Score = 85.1 bits (209), Expect = 2e-14 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -2 Query: 139 KGTRQVTRAAVEFYGPERAKWLGPFSENATPDYLTGEFAGDYGWDT 2 +G+RQVTRA+VEFYGP+RAKWLGPFS+ A P YL GEF GDYGWD+ Sbjct: 19 RGSRQVTRASVEFYGPDRAKWLGPFSDGAVPSYLKGEFPGDYGWDS 64 >gb|ABD37899.1| light-harvesting chlorophyll-a/b binding protein LhcbM2 [Acutodesmus obliquus] Length = 249 Score = 83.2 bits (204), Expect = 6e-14 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 139 KGTRQVTRAAVEFYGPERAKWLGPFSENATPDYLTGEFAGDYGWDT 2 + TRQVTRAA+E+YGP+R K+LGPFSE TP YLTGEFAGDYGWDT Sbjct: 17 RATRQVTRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFAGDYGWDT 62 >ref|XP_002952704.1| light-harvesting chlorophyll a/b-binding protein [Volvox carteri f. nagariensis] gi|300262048|gb|EFJ46257.1| light-harvesting chlorophyll a/b-binding protein [Volvox carteri f. nagariensis] Length = 251 Score = 82.4 bits (202), Expect = 1e-13 Identities = 40/66 (60%), Positives = 48/66 (72%) Frame = -2 Query: 199 ALAQKSFLGSTLRPVAPTQGKGTRQVTRAAVEFYGPERAKWLGPFSENATPDYLTGEFAG 20 A+ KS L S++RP A + R V RAA+E+YGP+R K+LGPFSE TP YLTGEF G Sbjct: 2 AVVAKSALRSSVRP-ATVASRAARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFPG 60 Query: 19 DYGWDT 2 DYGWDT Sbjct: 61 DYGWDT 66 >tpg|DAA05914.1| TPA_inf: chloroplast light-harvesting complex II protein precursor Lhcbm2 [Acetabularia acetabulum] Length = 248 Score = 82.4 bits (202), Expect = 1e-13 Identities = 38/64 (59%), Positives = 49/64 (76%), Gaps = 1/64 (1%) Frame = -2 Query: 190 QKSFLGSTLRPVAPTQGKGTRQVT-RAAVEFYGPERAKWLGPFSENATPDYLTGEFAGDY 14 Q S +G+T + P KG ++V+ +AAVE+YGP+RAKWLGP+S+ A P YLTGEF GDY Sbjct: 3 QTSLVGTTTKSTLP---KGNKRVSVQAAVEWYGPDRAKWLGPYSDGAVPSYLTGEFPGDY 59 Query: 13 GWDT 2 GWDT Sbjct: 60 GWDT 63 >ref|XP_001693987.1| light-harvesting protein of photosystem II [Chlamydomonas reinhardtii] gi|15430556|dbj|BAB64413.1| light-harvesting chlorophyll-a/b binding protein LhcII-3 [Chlamydomonas reinhardtii] gi|15430564|dbj|BAB64417.1| light-harvesting chlorophyll-a/b binding protein LhcII-3 [Chlamydomonas reinhardtii] gi|158277154|gb|EDP02923.1| light-harvesting protein of photosystem II [Chlamydomonas reinhardtii] Length = 249 Score = 81.6 bits (200), Expect = 2e-13 Identities = 39/66 (59%), Positives = 47/66 (71%) Frame = -2 Query: 199 ALAQKSFLGSTLRPVAPTQGKGTRQVTRAAVEFYGPERAKWLGPFSENATPDYLTGEFAG 20 A KS + S++RP G+ R V RAA+E+YGP+R K+LGPFSE TP YLTGEF G Sbjct: 2 AAIMKSAVRSSVRPTV--SGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFPG 59 Query: 19 DYGWDT 2 DYGWDT Sbjct: 60 DYGWDT 65 >sp|P27517.1|CB2_DUNTE RecName: Full=Chlorophyll a-b binding protein of LHCII type I, chloroplastic; Short=CAB; Short=LHCP; Flags: Precursor [Dunaliella tertiolecta] gi|167985|gb|AAA62772.1| 28.5 kDa LHCII apoprotein [Dunaliella tertiolecta] Length = 253 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = -2 Query: 157 VAPTQGKGTRQVTRAAVEFYGPERAKWLGPFSENATPDYLTGEFAGDYGWDT 2 + T+ + V RAAVEFYGP+RAK+LGPFSEN TP+YLTGEF GDYGWDT Sbjct: 15 IRQTRQQRMATVPRAAVEFYGPDRAKFLGPFSENDTPEYLTGEFPGDYGWDT 66 >gb|ABD37910.1| light-harvesting chlorophyll-a/b binding protein LhcbM2a [Chlamydomonas incerta] Length = 246 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/62 (61%), Positives = 46/62 (74%) Frame = -2 Query: 187 KSFLGSTLRPVAPTQGKGTRQVTRAAVEFYGPERAKWLGPFSENATPDYLTGEFAGDYGW 8 KS + S++RP G+ R V RAA+E+YGP+R K+LGPFSE TP YLTGEF GDYGW Sbjct: 3 KSAVRSSVRPTV--SGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFPGDYGW 60 Query: 7 DT 2 DT Sbjct: 61 DT 62 >gb|ABD91646.1| major light-harvesting chlorophyll a/b protein 2.1 [Dunaliella salina] gi|90191873|gb|ABD91648.1| major light-harvesting chlorophyll a/b protein 2.1 [Dunaliella salina] Length = 253 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = -2 Query: 157 VAPTQGKGTRQVTRAAVEFYGPERAKWLGPFSENATPDYLTGEFAGDYGWDT 2 + T+ + V RAAVEFYGP+RAK+LGPFSEN TP+YLTGEF GDYGWDT Sbjct: 15 IRQTRQQRMATVPRAAVEFYGPDRAKFLGPFSENDTPEYLTGEFPGDYGWDT 66 >gb|ABD91647.1| major light-harvesting chlorophyll a/b protein 2.2 [Dunaliella salina] gi|90191875|gb|ABD91649.1| major light-harvesting chlorophyll a/b protein 2.2 [Dunaliella salina] Length = 253 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = -2 Query: 157 VAPTQGKGTRQVTRAAVEFYGPERAKWLGPFSENATPDYLTGEFAGDYGWDT 2 + T+ + V RAAVEFYGP+RAK+LGPFSEN TP+YLTGEF GDYGWDT Sbjct: 15 IRQTRQQRMATVPRAAVEFYGPDRAKFLGPFSENDTPEYLTGEFPGDYGWDT 66 >sp|P14273.1|CB2_CHLRE RecName: Full=Chlorophyll a-b binding protein of LHCII type I, chloroplastic; Short=CAB; Short=LHCP; Flags: Precursor gi|20269802|gb|AAM18056.1|AF495472_1 major light-harvesting complex II protein m6 [Chlamydomonas reinhardtii] gi|167409|gb|AAA33082.1| chlorophyll a/b-binding protein [Chlamydomonas reinhardtii] Length = 253 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/69 (55%), Positives = 42/69 (60%) Frame = -2 Query: 208 MTSALAQKSFLGSTLRPVAPTQGKGTRQVTRAAVEFYGPERAKWLGPFSENATPDYLTGE 29 M ALA + L T + + VEFYGP RAKWLGP+SENATP YLTGE Sbjct: 1 MAFALASRKALQVTCKATGKKTAAKAAAPKSSGVEFYGPNRAKWLGPYSENATPAYLTGE 60 Query: 28 FAGDYGWDT 2 F GDYGWDT Sbjct: 61 FPGDYGWDT 69