BLASTX nr result
ID: Cinnamomum23_contig00022171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00022171 (538 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010089359.1| Disease resistance protein [Morus notabilis]... 60 4e-07 >ref|XP_010089359.1| Disease resistance protein [Morus notabilis] gi|587847320|gb|EXB37703.1| Disease resistance protein [Morus notabilis] Length = 985 Score = 60.5 bits (145), Expect = 4e-07 Identities = 34/104 (32%), Positives = 55/104 (52%) Frame = -3 Query: 350 NLRNLERDMKSLREETDELSAQEEDVMTXXXXXXXXXXXXXXXXVDVWLENVKRFKKEVD 171 N RNL M+ L+ + ++L+ +E+DV++ V+ WLE VKR K EV Sbjct: 16 NYRNLNEKMQKLKRKLEDLTCREDDVISELEYAESLSLKRRKREVENWLERVKRRKDEVQ 75 Query: 170 GAEENVREKRGWISRYKLAKHIEDLKAEVVRLKEKNGFSDGVAI 39 E+ V+ +R +R +L K +E+L EV L E+ F G+ + Sbjct: 76 IMEQAVKRERRLSTRVRLGKCVEELTGEVTELLEQGRFCKGLIL 119