BLASTX nr result
ID: Cinnamomum23_contig00022153
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00022153 (232 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006398736.1| hypothetical protein EUTSA_v10012789mg [Eutr... 61 3e-07 ref|XP_010452129.1| PREDICTED: two-component response regulator-... 60 4e-07 ref|XP_006287142.1| hypothetical protein CARUB_v10000314mg [Caps... 60 4e-07 ref|XP_003606528.1| Two-component response regulator-like PRR73 ... 60 4e-07 ref|XP_010112318.1| Two-component response regulator-like protei... 58 2e-06 emb|CBI16234.3| unnamed protein product [Vitis vinifera] 58 2e-06 ref|XP_002281776.1| PREDICTED: two-component response regulator-... 58 2e-06 ref|XP_002531836.1| sensory transduction histidine kinase, putat... 58 2e-06 dbj|BAE72697.1| pseudo-response regulator 37 homologue [Lemna pa... 58 2e-06 dbj|BAE72700.1| pseudo-response regulator 37 homologue [Lemna gi... 58 2e-06 ref|XP_010543355.1| PREDICTED: two-component response regulator-... 58 3e-06 ref|XP_010034612.1| PREDICTED: two-component response regulator-... 58 3e-06 gb|KCW52766.1| hypothetical protein EUGRSUZ_J02111 [Eucalyptus g... 58 3e-06 ref|XP_010100843.1| Two-component response regulator-like protei... 57 4e-06 ref|XP_012831940.1| PREDICTED: two-component response regulator-... 57 4e-06 ref|XP_011094752.1| PREDICTED: two-component response regulator-... 57 4e-06 gb|KHN48336.1| Two-component response regulator-like APRR7 [Glyc... 57 4e-06 ref|XP_010666901.1| PREDICTED: two-component response regulator-... 57 4e-06 ref|XP_010666898.1| PREDICTED: two-component response regulator-... 57 4e-06 ref|XP_010558289.1| PREDICTED: LOW QUALITY PROTEIN: two-componen... 57 4e-06 >ref|XP_006398736.1| hypothetical protein EUTSA_v10012789mg [Eutrema salsugineum] gi|557099826|gb|ESQ40189.1| hypothetical protein EUTSA_v10012789mg [Eutrema salsugineum] Length = 545 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 133 VLCAVMSSHDSMGIVFSCLSKGAVDFLVKPIRK 231 ++ AVMSSHDSMG+VF CLSKGAVDFLVKPIRK Sbjct: 10 LIVAVMSSHDSMGLVFKCLSKGAVDFLVKPIRK 42 >ref|XP_010452129.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Camelina sativa] gi|727559750|ref|XP_010452130.1| PREDICTED: two-component response regulator-like APRR7 isoform X2 [Camelina sativa] Length = 584 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 133 VLCAVMSSHDSMGIVFSCLSKGAVDFLVKPIRK 231 + AVMSSHDSMG+VF CLSKGAVDFLVKPIRK Sbjct: 10 ICVAVMSSHDSMGLVFKCLSKGAVDFLVKPIRK 42 >ref|XP_006287142.1| hypothetical protein CARUB_v10000314mg [Capsella rubella] gi|482555848|gb|EOA20040.1| hypothetical protein CARUB_v10000314mg [Capsella rubella] Length = 581 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 133 VLCAVMSSHDSMGIVFSCLSKGAVDFLVKPIRK 231 + AVMSSHDSMG+VF CLSKGAVDFLVKPIRK Sbjct: 10 IYVAVMSSHDSMGLVFKCLSKGAVDFLVKPIRK 42 >ref|XP_003606528.1| Two-component response regulator-like PRR73 [Medicago truncatula] Length = 830 Score = 60.5 bits (145), Expect = 4e-07 Identities = 39/77 (50%), Positives = 45/77 (58%) Frame = +1 Query: 1 LKNIPVISEYFS*TPFSLLANFVNIHALYENAIFI*YFYC*T**VLCAVMSSHDSMGIVF 180 LKNIPVIS+ S + + I A F+C + AVMS HDSMGIVF Sbjct: 162 LKNIPVISKCHSKPKLCTIFLCILIIAHL-------VFWCTEHIEMYAVMSCHDSMGIVF 214 Query: 181 SCLSKGAVDFLVKPIRK 231 CLSKGA DFLVKPIR+ Sbjct: 215 KCLSKGAADFLVKPIRR 231 >ref|XP_010112318.1| Two-component response regulator-like protein [Morus notabilis] gi|587946891|gb|EXC33207.1| Two-component response regulator-like protein [Morus notabilis] Length = 755 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 145 VMSSHDSMGIVFSCLSKGAVDFLVKPIRK 231 +MSSHDSMGIVF CLSKGAVDFLVKPIRK Sbjct: 152 MMSSHDSMGIVFKCLSKGAVDFLVKPIRK 180 >emb|CBI16234.3| unnamed protein product [Vitis vinifera] Length = 482 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 145 VMSSHDSMGIVFSCLSKGAVDFLVKPIRK 231 +MSSHDSMGIVF CLSKGAVDFLVKPIRK Sbjct: 175 MMSSHDSMGIVFKCLSKGAVDFLVKPIRK 203 >ref|XP_002281776.1| PREDICTED: two-component response regulator-like PRR37 [Vitis vinifera] Length = 785 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 145 VMSSHDSMGIVFSCLSKGAVDFLVKPIRK 231 +MSSHDSMGIVF CLSKGAVDFLVKPIRK Sbjct: 175 MMSSHDSMGIVFKCLSKGAVDFLVKPIRK 203 >ref|XP_002531836.1| sensory transduction histidine kinase, putative [Ricinus communis] gi|223528532|gb|EEF30556.1| sensory transduction histidine kinase, putative [Ricinus communis] Length = 807 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 145 VMSSHDSMGIVFSCLSKGAVDFLVKPIRK 231 +MSSHDSMGIVF CLSKGAVDFLVKPIRK Sbjct: 154 MMSSHDSMGIVFKCLSKGAVDFLVKPIRK 182 >dbj|BAE72697.1| pseudo-response regulator 37 homologue [Lemna paucicostata] Length = 617 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 145 VMSSHDSMGIVFSCLSKGAVDFLVKPIRK 231 +MSSHDSMGIVF CLSKGAVDFLVKPIRK Sbjct: 157 MMSSHDSMGIVFKCLSKGAVDFLVKPIRK 185 >dbj|BAE72700.1| pseudo-response regulator 37 homologue [Lemna gibba] Length = 623 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 145 VMSSHDSMGIVFSCLSKGAVDFLVKPIRK 231 +MSSHDSMGIVF CLSKGAVDFLVKPIRK Sbjct: 157 MMSSHDSMGIVFKCLSKGAVDFLVKPIRK 185 >ref|XP_010543355.1| PREDICTED: two-component response regulator-like APRR7 [Tarenaya hassleriana] gi|729350789|ref|XP_010543356.1| PREDICTED: two-component response regulator-like APRR7 [Tarenaya hassleriana] gi|729350792|ref|XP_010543357.1| PREDICTED: two-component response regulator-like APRR7 [Tarenaya hassleriana] Length = 701 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 145 VMSSHDSMGIVFSCLSKGAVDFLVKPIRK 231 +MSSHDSMG+VF CLSKGAVDFLVKPIRK Sbjct: 165 MMSSHDSMGVVFKCLSKGAVDFLVKPIRK 193 >ref|XP_010034612.1| PREDICTED: two-component response regulator-like PRR37 [Eucalyptus grandis] Length = 778 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 145 VMSSHDSMGIVFSCLSKGAVDFLVKPIRK 231 +MSSHDSMGIVF CLSKGAVDFLVKPIRK Sbjct: 181 MMSSHDSMGIVFRCLSKGAVDFLVKPIRK 209 >gb|KCW52766.1| hypothetical protein EUGRSUZ_J02111 [Eucalyptus grandis] Length = 629 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 145 VMSSHDSMGIVFSCLSKGAVDFLVKPIRK 231 +MSSHDSMGIVF CLSKGAVDFLVKPIRK Sbjct: 181 MMSSHDSMGIVFRCLSKGAVDFLVKPIRK 209 >ref|XP_010100843.1| Two-component response regulator-like protein [Morus notabilis] gi|587896341|gb|EXB84826.1| Two-component response regulator-like protein [Morus notabilis] Length = 779 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 145 VMSSHDSMGIVFSCLSKGAVDFLVKPIRK 231 +MSSHDSMG+VF CLSKGAVDFLVKPIRK Sbjct: 170 MMSSHDSMGLVFKCLSKGAVDFLVKPIRK 198 >ref|XP_012831940.1| PREDICTED: two-component response regulator-like APRR7 [Erythranthe guttatus] Length = 686 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 145 VMSSHDSMGIVFSCLSKGAVDFLVKPIRK 231 +MSSHDSMG+VF CLSKGAVDFLVKPIRK Sbjct: 162 MMSSHDSMGLVFKCLSKGAVDFLVKPIRK 190 >ref|XP_011094752.1| PREDICTED: two-component response regulator-like APRR3 [Sesamum indicum] Length = 706 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 145 VMSSHDSMGIVFSCLSKGAVDFLVKPIRK 231 +MSSHDSMG+VF CLSKGAVDFLVKPIRK Sbjct: 163 MMSSHDSMGLVFKCLSKGAVDFLVKPIRK 191 >gb|KHN48336.1| Two-component response regulator-like APRR7 [Glycine soja] Length = 755 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 145 VMSSHDSMGIVFSCLSKGAVDFLVKPIRK 231 +MSSHDSMG+VF CLSKGAVDFLVKPIRK Sbjct: 167 MMSSHDSMGLVFKCLSKGAVDFLVKPIRK 195 >ref|XP_010666901.1| PREDICTED: two-component response regulator-like APRR7 isoform X2 [Beta vulgaris subsp. vulgaris] Length = 749 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 145 VMSSHDSMGIVFSCLSKGAVDFLVKPIRK 231 +MSSHDSMG+VF CLSKGAVDFLVKPIRK Sbjct: 164 MMSSHDSMGLVFKCLSKGAVDFLVKPIRK 192 >ref|XP_010666898.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Beta vulgaris subsp. vulgaris] gi|731374222|ref|XP_010666899.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Beta vulgaris subsp. vulgaris] gi|731374226|ref|XP_010666900.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Beta vulgaris subsp. vulgaris] Length = 750 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 145 VMSSHDSMGIVFSCLSKGAVDFLVKPIRK 231 +MSSHDSMG+VF CLSKGAVDFLVKPIRK Sbjct: 164 MMSSHDSMGLVFKCLSKGAVDFLVKPIRK 192 >ref|XP_010558289.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator-like APRR7 [Tarenaya hassleriana] Length = 688 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 145 VMSSHDSMGIVFSCLSKGAVDFLVKPIRK 231 +MSSHDSMG+VF CLSKGAVDFLVKPIRK Sbjct: 172 MMSSHDSMGLVFKCLSKGAVDFLVKPIRK 200