BLASTX nr result
ID: Cinnamomum23_contig00021696
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00021696 (315 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001590285.1| predicted protein [Sclerotinia sclerotiorum ... 58 3e-06 ref|XP_003000447.1| conserved hypothetical protein [Verticillium... 56 8e-06 >ref|XP_001590285.1| predicted protein [Sclerotinia sclerotiorum 1980] gi|154693446|gb|EDN93184.1| predicted protein [Sclerotinia sclerotiorum 1980 UF-70] Length = 454 Score = 57.8 bits (138), Expect = 3e-06 Identities = 33/75 (44%), Positives = 39/75 (52%), Gaps = 3/75 (4%) Frame = -1 Query: 312 GVSXXXXXXXXXALVKFFDYRCLAPAQIIPGSGPLLQSICTDCDCPVASDPDCGAYGPII 133 GVS +L + F YRCL PA I+P G LQSICTD CP+AS+ C +Y I Sbjct: 192 GVSASDLMIIGYSLRQSFGYRCLPPATIVPSQGAQLQSICTDPTCPLASNNTCASYDQTI 251 Query: 132 ---KPVPTQSAAQAC 97 K P A AC Sbjct: 252 TKPKLEPCYVAEAAC 266 >ref|XP_003000447.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] gi|261361104|gb|EEY23532.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] Length = 307 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/77 (36%), Positives = 36/77 (46%) Frame = -1 Query: 312 GVSXXXXXXXXXALVKFFDYRCLAPAQIIPGSGPLLQSICTDCDCPVASDPDCGAYGPII 133 GV+ AL F+++CL A++IPG G LQSIC DCP A D C Y + Sbjct: 192 GVAKDDITAVGKALTDLFNFKCLPAAEVIPGQGKQLQSICIAEDCPEAKDAQCDLYKGAV 251 Query: 132 KPVPTQSAAQACAPQQT 82 P P + A T Sbjct: 252 APEPAHGGSNATMTSST 268