BLASTX nr result
ID: Cinnamomum23_contig00021206
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00021206 (413 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010258255.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 ref|XP_010040589.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 76 1e-11 gb|KCW63832.1| hypothetical protein EUGRSUZ_G01504 [Eucalyptus g... 76 1e-11 gb|KCW45077.1| hypothetical protein EUGRSUZ_L01320 [Eucalyptus g... 76 1e-11 ref|XP_008236630.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_010999833.1| PREDICTED: pentatricopeptide repeat-containi... 74 4e-11 ref|XP_002313087.2| hypothetical protein POPTR_0009s11000g [Popu... 74 4e-11 ref|XP_009379614.1| PREDICTED: pentatricopeptide repeat-containi... 74 5e-11 ref|XP_007201413.1| hypothetical protein PRUPE_ppa001679mg [Prun... 74 5e-11 ref|XP_006409500.1| hypothetical protein EUTSA_v10022548mg [Eutr... 73 9e-11 ref|XP_007042349.1| Endonucleases isoform 2 [Theobroma cacao] gi... 72 1e-10 ref|XP_007042348.1| Pentatricopeptide repeat-containing protein ... 72 1e-10 ref|XP_002521838.1| pentatricopeptide repeat-containing protein,... 71 2e-10 ref|XP_006838669.2| PREDICTED: pentatricopeptide repeat-containi... 71 3e-10 gb|ERN01238.1| hypothetical protein AMTR_s00002p00243140 [Ambore... 71 3e-10 ref|XP_004292454.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 ref|XP_010530875.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-10 ref|XP_010933063.1| PREDICTED: pentatricopeptide repeat-containi... 70 7e-10 ref|XP_006296983.1| hypothetical protein CARUB_v10012977mg, part... 70 7e-10 emb|CBI32449.3| unnamed protein product [Vitis vinifera] 69 9e-10 >ref|XP_010258255.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820 [Nelumbo nucifera] Length = 838 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = -1 Query: 413 ERVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPY 288 ERVVK LKTKSLD RVKRKG+VFWIGF GSNA WFWKLTEPY Sbjct: 751 ERVVKTLKTKSLDCRVKRKGRVFWIGFFGSNAVWFWKLTEPY 792 >ref|XP_010040589.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g15820-like [Eucalyptus grandis] Length = 821 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/68 (54%), Positives = 42/68 (61%) Frame = -1 Query: 413 ERVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPYXXXXXXXXXXXXDQILMN 234 ERVVKALK KSLD RVKRKG+V+WIG GSN+ WFWKL EPY + + N Sbjct: 746 ERVVKALKAKSLDCRVKRKGQVYWIGLLGSNSTWFWKLIEPYVLDLNFAQEDDGEILSFN 805 Query: 233 QGQHIDFN 210 G D N Sbjct: 806 SGSDSDKN 813 >gb|KCW63832.1| hypothetical protein EUGRSUZ_G01504 [Eucalyptus grandis] Length = 708 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/68 (54%), Positives = 42/68 (61%) Frame = -1 Query: 413 ERVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPYXXXXXXXXXXXXDQILMN 234 ERVVKALK KSLD RVKRKG+V+WIG GSN+ WFWKL EPY + + N Sbjct: 633 ERVVKALKAKSLDCRVKRKGQVYWIGLLGSNSTWFWKLIEPYVLDLNFAQEDDGEILSFN 692 Query: 233 QGQHIDFN 210 G D N Sbjct: 693 SGSDSDKN 700 >gb|KCW45077.1| hypothetical protein EUGRSUZ_L01320 [Eucalyptus grandis] Length = 806 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/68 (54%), Positives = 42/68 (61%) Frame = -1 Query: 413 ERVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPYXXXXXXXXXXXXDQILMN 234 ERVVKALK KSLD RVKRKG+V+WIG GSN+ WFWKL EPY + + N Sbjct: 731 ERVVKALKAKSLDCRVKRKGQVYWIGLLGSNSTWFWKLIEPYVLDLNFAQEDDGEILSFN 790 Query: 233 QGQHIDFN 210 G D N Sbjct: 791 SGSDSDKN 798 >ref|XP_008236630.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820 [Prunus mume] Length = 830 Score = 75.5 bits (184), Expect = 1e-11 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -1 Query: 413 ERVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPY 288 E++V+ALK KSLD +VKRKG+VFWIGF GSN+ WFWKL EPY Sbjct: 740 EKIVRALKAKSLDCKVKRKGRVFWIGFLGSNSTWFWKLVEPY 781 >ref|XP_010999833.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820 [Populus euphratica] Length = 819 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -1 Query: 410 RVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPY 288 RVVK LK+KSLD RVKRKGKVFWIGF GS + WFWKL EPY Sbjct: 732 RVVKTLKSKSLDCRVKRKGKVFWIGFLGSVSTWFWKLVEPY 772 >ref|XP_002313087.2| hypothetical protein POPTR_0009s11000g [Populus trichocarpa] gi|550331483|gb|EEE87042.2| hypothetical protein POPTR_0009s11000g [Populus trichocarpa] Length = 622 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -1 Query: 410 RVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPY 288 RVVK LK+KSLD RVKRKGKVFWIGF GS + WFWKL EPY Sbjct: 535 RVVKTLKSKSLDCRVKRKGKVFWIGFLGSVSTWFWKLVEPY 575 >ref|XP_009379614.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820 [Pyrus x bretschneideri] Length = 830 Score = 73.6 bits (179), Expect = 5e-11 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -1 Query: 413 ERVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPY 288 E++VK+LK KSLD +VKRKG+VFWIGF GS++ WFWKL EPY Sbjct: 742 EKIVKSLKAKSLDCKVKRKGRVFWIGFLGSSSTWFWKLVEPY 783 >ref|XP_007201413.1| hypothetical protein PRUPE_ppa001679mg [Prunus persica] gi|462396813|gb|EMJ02612.1| hypothetical protein PRUPE_ppa001679mg [Prunus persica] Length = 781 Score = 73.6 bits (179), Expect = 5e-11 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -1 Query: 413 ERVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPY 288 E++V+ALK KSLD +VKRKG+ FWIGF GSN+ WFWKL EPY Sbjct: 691 EKIVRALKAKSLDCKVKRKGRYFWIGFLGSNSTWFWKLVEPY 732 >ref|XP_006409500.1| hypothetical protein EUTSA_v10022548mg [Eutrema salsugineum] gi|557110662|gb|ESQ50953.1| hypothetical protein EUTSA_v10022548mg [Eutrema salsugineum] Length = 848 Score = 72.8 bits (177), Expect = 9e-11 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 3/71 (4%) Frame = -1 Query: 413 ERVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPYXXXXXXXXXXXXDQILMN 234 E+VVKAL+ KS++ RVK+KGKVFWIG QG+N+AWFWKL EP+ + + N Sbjct: 754 EKVVKALRGKSMECRVKKKGKVFWIGLQGTNSAWFWKLIEPHVLEEMKDHLKPASESMNN 813 Query: 233 QG---QHIDFN 210 G Q I+F+ Sbjct: 814 DGDEEQSINFD 824 >ref|XP_007042349.1| Endonucleases isoform 2 [Theobroma cacao] gi|508706284|gb|EOX98180.1| Endonucleases isoform 2 [Theobroma cacao] Length = 621 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -1 Query: 413 ERVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPY 288 E+VVK LK K+L RVKRKGKV+WIGF GSN+ WFWKL EPY Sbjct: 534 EKVVKTLKAKTLHCRVKRKGKVYWIGFLGSNSMWFWKLVEPY 575 >ref|XP_007042348.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] gi|508706283|gb|EOX98179.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] Length = 823 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -1 Query: 413 ERVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPY 288 E+VVK LK K+L RVKRKGKV+WIGF GSN+ WFWKL EPY Sbjct: 736 EKVVKTLKAKTLHCRVKRKGKVYWIGFLGSNSMWFWKLVEPY 777 >ref|XP_002521838.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538876|gb|EEF40474.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 835 Score = 71.2 bits (173), Expect = 2e-10 Identities = 33/68 (48%), Positives = 45/68 (66%) Frame = -1 Query: 413 ERVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPYXXXXXXXXXXXXDQILMN 234 E+V K LK+KSL+ +VKRKG+VFWIGF G+++ WFWKL EPY DQ L Sbjct: 755 EKVFKTLKSKSLNCKVKRKGRVFWIGFLGNDSVWFWKLVEPYILDDLKLFLKAGDQTLEY 814 Query: 233 QGQHIDFN 210 ++I+F+ Sbjct: 815 SAENINFD 822 >ref|XP_006838669.2| PREDICTED: pentatricopeptide repeat-containing protein At2g15820 [Amborella trichopoda] Length = 813 Score = 70.9 bits (172), Expect = 3e-10 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 413 ERVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPY 288 ERV+K LK KSLD R KRKG+VFWI QG+NA WFWKL EP+ Sbjct: 709 ERVIKTLKAKSLDCRFKRKGRVFWIACQGNNATWFWKLVEPH 750 >gb|ERN01238.1| hypothetical protein AMTR_s00002p00243140 [Amborella trichopoda] Length = 789 Score = 70.9 bits (172), Expect = 3e-10 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 413 ERVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPY 288 ERV+K LK KSLD R KRKG+VFWI QG+NA WFWKL EP+ Sbjct: 685 ERVIKTLKAKSLDCRFKRKGRVFWIACQGNNATWFWKLVEPH 726 >ref|XP_004292454.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820 [Fragaria vesca subsp. vesca] Length = 794 Score = 70.5 bits (171), Expect = 4e-10 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -1 Query: 413 ERVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPY 288 +++V+ LKT+SLD +VKRKG+VFWIGF GSN+ FWKLTEPY Sbjct: 706 QKIVRTLKTRSLDCKVKRKGRVFWIGFLGSNSTLFWKLTEPY 747 >ref|XP_010530875.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820 [Tarenaya hassleriana] Length = 844 Score = 70.1 bits (170), Expect = 6e-10 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -1 Query: 413 ERVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPY 288 E+VVK L+ KSL+ RVK+KG+VFW+GF G N+ WFWKL EPY Sbjct: 765 EKVVKVLRAKSLECRVKKKGQVFWLGFLGKNSTWFWKLVEPY 806 >ref|XP_010933063.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820 [Elaeis guineensis] Length = 816 Score = 69.7 bits (169), Expect = 7e-10 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -1 Query: 413 ERVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPY 288 ER+VKAL+ KSL RVKRKGKVFWIG QGSNA FWKLTE Y Sbjct: 735 ERIVKALQAKSLACRVKRKGKVFWIGLQGSNADAFWKLTESY 776 >ref|XP_006296983.1| hypothetical protein CARUB_v10012977mg, partial [Capsella rubella] gi|482565692|gb|EOA29881.1| hypothetical protein CARUB_v10012977mg, partial [Capsella rubella] Length = 835 Score = 69.7 bits (169), Expect = 7e-10 Identities = 33/66 (50%), Positives = 43/66 (65%) Frame = -1 Query: 413 ERVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPYXXXXXXXXXXXXDQILMN 234 E+VVKAL+ KS++ RVK+KGKVFWIG QG+N+A FWKL EPY + + N Sbjct: 761 EKVVKALRGKSMECRVKKKGKVFWIGLQGTNSALFWKLIEPYVLEDLKDHLKPASESMGN 820 Query: 233 QGQHID 216 G+ D Sbjct: 821 DGEGED 826 >emb|CBI32449.3| unnamed protein product [Vitis vinifera] Length = 790 Score = 69.3 bits (168), Expect = 9e-10 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -1 Query: 413 ERVVKALKTKSLDSRVKRKGKVFWIGFQGSNAAWFWKLTEPY 288 E+VV+ LK +S+D RVKRKG VFWIG GSN+ WFWKL EPY Sbjct: 711 EKVVRTLKAQSMDCRVKRKGTVFWIGLLGSNSTWFWKLIEPY 752