BLASTX nr result
ID: Cinnamomum23_contig00020655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00020655 (571 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006644067.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_008778136.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 ref|XP_010922078.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-06 emb|CDP09580.1| unnamed protein product [Coffea canephora] 56 1e-05 >ref|XP_006644067.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Oryza brachyantha] Length = 594 Score = 58.5 bits (140), Expect = 2e-06 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 5/72 (6%) Frame = -3 Query: 509 LFPSIFCF-----FHSVMQFWLVVEHHKLPDLDEQEYASHLDLIDKVHGLVKTKKYITEI 345 LF I C + +Q VE KL DL E++YASH+DL+ KVHG+ K +KYI +I Sbjct: 160 LFYVILCLRKRKLYRKALQLLEYVEESKLLDLGERDYASHVDLVAKVHGIYKAEKYIEDI 219 Query: 344 PKLFHGKGFWRT 309 P G+ +RT Sbjct: 220 PASHRGEIVYRT 231 >ref|XP_008778136.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like, partial [Phoenix dactylifera] Length = 610 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/60 (46%), Positives = 41/60 (68%) Frame = -3 Query: 488 FFHSVMQFWLVVEHHKLPDLDEQEYASHLDLIDKVHGLVKTKKYITEIPKLFHGKGFWRT 309 F+ +QF +E +K + E++YASHLDL+ KVHGL K +KYI +IP+ F G+ +RT Sbjct: 189 FYAKALQFIEWLEANKRIEPVERDYASHLDLVAKVHGLQKAEKYIEKIPESFRGEVIYRT 248 >ref|XP_010922078.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like [Elaeis guineensis] Length = 650 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/60 (46%), Positives = 39/60 (65%) Frame = -3 Query: 488 FFHSVMQFWLVVEHHKLPDLDEQEYASHLDLIDKVHGLVKTKKYITEIPKLFHGKGFWRT 309 F+ +QF +E K + E++YASHLDL+ KVHGL K +KYI IP+ F G+ +RT Sbjct: 229 FYQKALQFVEWLEASKHLNFVERDYASHLDLVAKVHGLQKAEKYINMIPESFRGEIIYRT 288 >emb|CDP09580.1| unnamed protein product [Coffea canephora] Length = 249 Score = 56.2 bits (134), Expect = 1e-05 Identities = 30/61 (49%), Positives = 40/61 (65%), Gaps = 2/61 (3%) Frame = -3 Query: 485 FHSVMQF--WLVVEHHKLPDLDEQEYASHLDLIDKVHGLVKTKKYITEIPKLFHGKGFWR 312 F S ++F WL +E H + E++YAS +DLI KVHGL KT+ YI IPK F G+ +R Sbjct: 69 FESALEFSEWLELEGH---EFGERDYASCVDLIAKVHGLQKTESYIANIPKSFQGEVVYR 125 Query: 311 T 309 T Sbjct: 126 T 126