BLASTX nr result
ID: Cinnamomum23_contig00020195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00020195 (294 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006391328.1| hypothetical protein EUTSA_v10018635mg [Eutr... 57 5e-06 gb|KJB81471.1| hypothetical protein B456_013G147100 [Gossypium r... 57 6e-06 gb|KJB43202.1| hypothetical protein B456_007G188300 [Gossypium r... 56 8e-06 gb|KJB43196.1| hypothetical protein B456_007G188300 [Gossypium r... 56 8e-06 gb|KJB43195.1| hypothetical protein B456_007G188300 [Gossypium r... 56 8e-06 >ref|XP_006391328.1| hypothetical protein EUTSA_v10018635mg [Eutrema salsugineum] gi|557087762|gb|ESQ28614.1| hypothetical protein EUTSA_v10018635mg [Eutrema salsugineum] Length = 299 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -1 Query: 294 SEGGYVWACKNYDGDVQSDFVAEGLNAISSPVCYVDLY 181 SEGGYVWACKNYDGDVQSDF+A+G ++ + LY Sbjct: 261 SEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVLY 298 >gb|KJB81471.1| hypothetical protein B456_013G147100 [Gossypium raimondii] Length = 289 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = -1 Query: 294 SEGGYVWACKNYDGDVQSDFVAEGLN 217 SEGGYVWACKNYDGDVQSDF+A+GL+ Sbjct: 264 SEGGYVWACKNYDGDVQSDFLAQGLS 289 >gb|KJB43202.1| hypothetical protein B456_007G188300 [Gossypium raimondii] Length = 413 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -1 Query: 294 SEGGYVWACKNYDGDVQSDFVAEGL 220 SEGGYVWACKNYDGDVQSDF+A+GL Sbjct: 263 SEGGYVWACKNYDGDVQSDFLAQGL 287 >gb|KJB43196.1| hypothetical protein B456_007G188300 [Gossypium raimondii] Length = 304 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -1 Query: 294 SEGGYVWACKNYDGDVQSDFVAEGL 220 SEGGYVWACKNYDGDVQSDF+A+GL Sbjct: 263 SEGGYVWACKNYDGDVQSDFLAQGL 287 >gb|KJB43195.1| hypothetical protein B456_007G188300 [Gossypium raimondii] Length = 324 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/47 (55%), Positives = 36/47 (76%), Gaps = 3/47 (6%) Frame = -1 Query: 294 SEGGYVWACKNYDGDVQSDFVAEG---LNAISSPVCYVDLYIEVLLM 163 SEGGYVWACKNYDGDVQSDF+A+G L ++S + Y+ + ++L+ Sbjct: 263 SEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVYLMSTVYLILL 309