BLASTX nr result
ID: Cinnamomum23_contig00020078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00020078 (210 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010911714.1| PREDICTED: putative disease resistance prote... 67 4e-09 ref|XP_010937795.1| PREDICTED: putative disease resistance prote... 65 1e-08 ref|XP_010911079.1| PREDICTED: putative disease resistance prote... 65 2e-08 ref|XP_010937794.1| PREDICTED: disease resistance protein RGA2-l... 61 3e-07 ref|XP_011658447.1| PREDICTED: disease resistance protein RGA2-l... 59 2e-06 gb|KGN47681.1| hypothetical protein Csa_6G375730 [Cucumis sativus] 59 2e-06 ref|XP_010909616.1| PREDICTED: putative disease resistance prote... 57 5e-06 >ref|XP_010911714.1| PREDICTED: putative disease resistance protein RGA3, partial [Elaeis guineensis] Length = 464 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/68 (48%), Positives = 45/68 (66%) Frame = -3 Query: 205 FEYQMSNKVREVVERLDAIARDRSNFNLRHEDDVDRHKEAGARVQTHSFVHELEVLGRKE 26 F +M NK++E+VERLD IA +RS F+L VDR R +THSFV+E ++GR+E Sbjct: 114 FRIRMMNKIKEIVERLDNIAAERSKFHLTEIGPVDRRYLITERPETHSFVNESNIIGREE 173 Query: 25 DNDKLVHL 2 D K+V L Sbjct: 174 DKKKIVEL 181 >ref|XP_010937795.1| PREDICTED: putative disease resistance protein RGA4 [Elaeis guineensis] Length = 1318 Score = 65.5 bits (158), Expect = 1e-08 Identities = 32/66 (48%), Positives = 44/66 (66%) Frame = -3 Query: 205 FEYQMSNKVREVVERLDAIARDRSNFNLRHEDDVDRHKEAGARVQTHSFVHELEVLGRKE 26 F M NK++E+VERLD IA +RS F+L VDR + R +THSFV+E ++GR+E Sbjct: 116 FRITMINKIKEIVERLDNIAMERSKFHLTEIGPVDRQYLSTERPETHSFVNESNIIGREE 175 Query: 25 DNDKLV 8 D K+V Sbjct: 176 DKKKIV 181 >ref|XP_010911079.1| PREDICTED: putative disease resistance protein RGA3, partial [Elaeis guineensis] Length = 520 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/66 (48%), Positives = 43/66 (65%) Frame = -3 Query: 205 FEYQMSNKVREVVERLDAIARDRSNFNLRHEDDVDRHKEAGARVQTHSFVHELEVLGRKE 26 F M NK++E+VERLD IA +RS F+L VDR + R +THSFV E ++GR+E Sbjct: 116 FRITMMNKIKEIVERLDNIAAERSKFHLTEIGPVDRQYLSTERPETHSFVKESNIIGREE 175 Query: 25 DNDKLV 8 D K+V Sbjct: 176 DKKKIV 181 >ref|XP_010937794.1| PREDICTED: disease resistance protein RGA2-like [Elaeis guineensis] Length = 1112 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/66 (45%), Positives = 43/66 (65%) Frame = -3 Query: 205 FEYQMSNKVREVVERLDAIARDRSNFNLRHEDDVDRHKEAGARVQTHSFVHELEVLGRKE 26 F M NK++++V+RLD IA +RS F+L VDR R +THSFV+E ++GR+E Sbjct: 116 FRITMINKIKKMVKRLDKIAAERSKFHLTEIGPVDRRYLITERPETHSFVNESNIIGREE 175 Query: 25 DNDKLV 8 D K+V Sbjct: 176 DKKKIV 181 >ref|XP_011658447.1| PREDICTED: disease resistance protein RGA2-like [Cucumis sativus] Length = 1088 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/68 (39%), Positives = 43/68 (63%) Frame = -3 Query: 208 AFEYQMSNKVREVVERLDAIARDRSNFNLRHEDDVDRHKEAGARVQTHSFVHELEVLGRK 29 AF +MS K++ V E+LDAIA D++ FNL + E+ R++T SF+ E E++GR Sbjct: 115 AFRLKMSQKIKRVREKLDAIAMDKTQFNLYENTREIQDDESTKRLETTSFIREGEIIGRD 174 Query: 28 EDNDKLVH 5 +D ++H Sbjct: 175 DDKKSIIH 182 >gb|KGN47681.1| hypothetical protein Csa_6G375730 [Cucumis sativus] Length = 917 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/68 (39%), Positives = 43/68 (63%) Frame = -3 Query: 208 AFEYQMSNKVREVVERLDAIARDRSNFNLRHEDDVDRHKEAGARVQTHSFVHELEVLGRK 29 AF +MS K++ V E+LDAIA D++ FNL + E+ R++T SF+ E E++GR Sbjct: 115 AFRLKMSQKIKRVREKLDAIAMDKTQFNLYENTREIQDDESTKRLETTSFIREGEIIGRD 174 Query: 28 EDNDKLVH 5 +D ++H Sbjct: 175 DDKKSIIH 182 >ref|XP_010909616.1| PREDICTED: putative disease resistance protein RGA4 [Elaeis guineensis] gi|743884196|ref|XP_010909617.1| PREDICTED: putative disease resistance protein RGA4 [Elaeis guineensis] Length = 244 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/66 (43%), Positives = 42/66 (63%) Frame = -3 Query: 205 FEYQMSNKVREVVERLDAIARDRSNFNLRHEDDVDRHKEAGARVQTHSFVHELEVLGRKE 26 F +M NK++E+V RLD IA ++S F+L DR R QTHSFV+E +++GR++ Sbjct: 69 FRIKMINKIKEIVGRLDNIAAEKSKFHLTEIGQADRQ-----RPQTHSFVNESQIIGREK 123 Query: 25 DNDKLV 8 D K V Sbjct: 124 DKKKTV 129